DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33253 and stom

DIOPT Version :9

Sequence 1:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster
Sequence 2:XP_004916682.2 Gene:stom / 100379777 XenbaseID:XB-GENE-995463 Length:303 Species:Xenopus tropicalis


Alignment Length:259 Identity:169/259 - (65%)
Similarity:214/259 - (82%) Gaps:1/259 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 END-DMGCVEILATVVSVLIMVLTFPISVFICFKVVSEYERAVIFRMGRLRSGGARGPGVFFVLP 125
            |:| .:||......::|....:|||||||::|.|:|.|||||:|||:||:..|||:|||:|||||
 Frog    43 ESDGGLGCCGWFLVILSFFFTLLTFPISVWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFVLP 107

  Fly   126 CVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRISDPLKAVIQVYNYSHSTSLLAATTL 190
            |.|.:..||:||:|||:||||:|:||||||:||.|||||:::...||..:.|...:|.|||.|||
 Frog   108 CTDSFINVDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTL 172

  Fly   191 RNVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVERVEIKDVSLPTALQRAMAAEAEAARE 255
            ||||||:|||::|::||.|:|.||.:||.|||.||:||||||||||.||..||||||||||||||
 Frog   173 RNVLGTKNLSQILSDREEIAHNMQSTLDVATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAARE 237

  Fly   256 ARAKVIAAEGEMKSSRALREASEIISASPSALQLRYLQTLSSISTEKNSTIIFPLPMELLTPFL 319
            ||||||||||||.:||||:|||.:||.||:||||||||||::|::||||||:||||::||..|:
 Frog   238 ARAKVIAAEGEMNASRALKEASIVISESPAALQLRYLQTLTTIASEKNSTIVFPLPLDLLKGFM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33253NP_001259699.1 PHB 92..239 CDD:214581 94/146 (64%)
SPFH_SLP-4 112..319 CDD:259813 143/206 (69%)
stomXP_004916682.2 SPFH_stomatin 94..295 CDD:259801 141/200 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 1 1.000 - - mtm9367
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.