DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic4 and PAC11

DIOPT Version :9

Sequence 1:NP_001368966.1 Gene:Sdic4 / 2768886 FlyBaseID:FBgn0053499 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_010776.1 Gene:PAC11 / 852099 SGDID:S000002896 Length:533 Species:Saccharomyces cerevisiae


Alignment Length:576 Identity:108/576 - (18%)
Similarity:197/576 - (34%) Gaps:188/576 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 STYSTLSGGKKQPLNLSVYNVQATNIPPKETLVYTKQTQT--------------TSTGGGNGDVL 61
            |..:.:..|.|      :...|:..:..||.:.|.|..||              |:|     |.:
Yeast    50 SVQTDMEEGSK------IQEPQSAYLRRKEVITYDKGIQTDQIEEEQLQENENHTTT-----DAV 103

  Fly    62 AFDAQGDDEESSLQNLGNGFTSKLPPGYLTHGLPTVKDVAPAITPLEIKK-ETEVKKEVNELSEE 125
            |.:....||.:..:...:....:|...:|      |::.|..::.....: ||||.....:....
Yeast   104 AIETTAADENNKDKAENDQPRLELAKPFL------VEEAAATLSNASFARLETEVSASGQQAPSN 162

  Fly   126 QKQMIILSENFQRFVVRAGRVIERALSENVDIYTD-------YIGG-------------GDSEEA 170
            .:|.   .:|..::         ..:|||:...||       |..|             .|.:.|
Yeast   163 MQQD---KDNLMQW---------NMVSENLQSETDCDCIAQEYDPGKGVLVVVYLRLPPADLQYA 215

  Fly   171 NDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGSYHNNEESPNEPDGVVMVWNTKFK 235
            :.|.:.:  .:|.|..|....:|..:..|                           |....|:..
Yeast   216 SSEAAWS--VVNVVKCDNASGRNGLLIDM---------------------------VEFRGTRIM 251

  Fly   236 KSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTP-------IQRTPLSAAA 293
            .:|....:|.:|.|:|          ||..|.:|:|:|::.|::::.|       :||..::...
Yeast   252 TATILRRYHPESNVIS----------ILLATLTGKIILYELRLKQKKPETPVVYVVQRNMVARHY 306

  Fly   294 HTHPVYC-LQMVGTQNAHNVISISSDGKLCSWS---LDMLSQPQ---------------DT---L 336
            ..|||.. ::....|:...|:..:.:|.:...|   |.:|.:||               ||   .
Yeast   307 FQHPVVAVIETSSVQDQERVLVAADNGNIMELSCLDLTVLRKPQQLRPVPLSQLLSLENDTCTYT 371

  Fly   337 ELQQRQSK--AIAITSMAFPANEINSLVMGSEDGYVY------------SASRHGLRSGVNEVYE 387
            |..||.:|  .:.|..||:.:.:...:.:|.|||.:|            |...:|.:..     |
Yeast   372 ERLQRLAKFDEVGIACMAYTSEDPQYVWIGGEDGGIYKVFWDQPGPLYLSLDNNGFQPA-----E 431

  Fly   388 RHLGPITGISTHYNQLSPDFGHLFLTSSIKI-WSLKLPISSCQFSVVSGINSNKPLY-------- 443
            .|...:||:..|::    |...|.|..|... |:::|..:....:::..     ||.        
Yeast   432 NHSTRVTGLEFHWD----DARRLMLLLSCSTDWTVRLWDARAGKAIIGA-----PLLLGGPVLRA 487

  Fly   444 ------SFEDNSDYMMDVAWSPVHPALFAAVDGSGRLDL--WNLNQDTEVPTASIV 491
                  :..:||..:....|.           ..|||.:  |..:..|.:.||:::
Yeast   488 RWLEKNNGGENSRTLRCQVWC-----------ADGRLVVVNWAFDAKTSLYTATVI 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic4NP_001368966.1 Dynein_IC2 23..51 CDD:402922 7/41 (17%)
WD40 196..523 CDD:421866 68/356 (19%)
WD40 repeat 196..245 CDD:293791 4/48 (8%)
WD40 repeat 251..289 CDD:293791 11/44 (25%)
WD40 repeat 298..337 CDD:293791 11/60 (18%)
WD40 repeat 349..446 CDD:293791 22/123 (18%)
WD40 repeat 452..490 CDD:293791 8/39 (21%)
WD40 repeat 498..524 CDD:293791
PAC11NP_010776.1 WD40 <433..466 CDD:395323 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101571
Panther 1 1.100 - - O PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.