DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic4 and Dnai1

DIOPT Version :9

Sequence 1:NP_001368966.1 Gene:Sdic4 / 2768886 FlyBaseID:FBgn0053499 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_780347.2 Gene:Dnai1 / 68922 MGIID:1916172 Length:701 Species:Mus musculus


Alignment Length:461 Identity:103/461 - (22%)
Similarity:213/461 - (46%) Gaps:58/461 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KDVAPAITPLEIKKETEVKKEVNELSEEQKQMIILSENFQRFVVRAGRVIERALSENV--DIYTD 160
            |:...|.||  :.|:|| |..:.:|:..:.|    |::..: |.:|.:::||.:::|.  |:..|
Mouse   246 KEKEKAKTP--VAKKTE-KMAMRKLTSMESQ----SDDITK-VTQAAKIVERMVNQNTYDDVAQD 302

  Fly   161 YIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPEL-VVGSYHNNEESPNEPD 224
            :....|:.:...::....|.|.:...|:  :|...:|::.|:..:.:| .||  |.:.:...:..
Mouse   303 FKYYEDTADEYRDQEGTLLPLWKFQNDK--AKRLAVTALCWNPKYKDLFAVG--HGSYDFMKQSR 363

  Fly   225 GVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPL 289
            |::::::.| ..|.||.:|..:|.:|.......:|.|::.|.|.|.:.:::.:.....|..|:..
Mouse   364 GMLLLYSMK-NPSFPEYMFSSESGIMCLDVHVDHPYLVVVGYYDGNVAIYNLKKPHSQPCFRSTS 427

  Fly   290 SAAAHTHPVYCLQMVGTQNAHNV--ISISSDGKLCSWSL--------DM--LSQPQDTLELQQRQ 342
            .:..||.||:.::.......||:  .|:||||::.||:|        |:  |.....|.|:.:..
Mouse   428 KSGKHTDPVWQVKWQKDDMDHNLNFFSVSSDGRIVSWTLVKSELVHIDIIKLKTEGSTTEIPEGL 492

  Fly   343 SKAIAITSMAFPAN-EINSL-VMGSEDGYVYSASRHGLRSGVNEVYERHLGPITGISTHYNQLSP 405
            .........||..: ||:.: ::|:|:|.:|..|: ...|...:.|:.|...:..:     ..:|
Mouse   493 QLHTVGCGTAFDFHKEIDYMFLVGTEEGKIYKCSK-SYSSQFLDTYDAHNMAVDAV-----LWNP 551

  Fly   406 DFGHLFLTSS----IKIWSLKLPISSCQFSVVSGINSNKPLYSFEDNSDYMMDVAWSPVHPALFA 466
            ....:|::.|    :|||...:               ..|::.::.|| .:.||||:|....:||
Mouse   552 YHTKVFMSCSSDWTVKIWDHTI---------------KTPMFIYDLNS-AVGDVAWAPYSSTVFA 600

  Fly   467 AVDGSGRLDLWNL--NQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLA 529
            ||...|:..:::|  |:...:....:|......:..|.:.|....:.:||:.|.:....::.||.
Mouse   601 AVTTDGKAHVFDLAVNKYEAICNQPVVAKKKNKITHVQFNPIHPIIIVGDDRGHIICLKLSPNLR 665

  Fly   530 QPSRDE 535
            :..:::
Mouse   666 KMPKEK 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic4NP_001368966.1 Dynein_IC2 23..51 CDD:402922
WD40 196..523 CDD:421866 78/347 (22%)
WD40 repeat 196..245 CDD:293791 12/49 (24%)
WD40 repeat 251..289 CDD:293791 7/37 (19%)
WD40 repeat 298..337 CDD:293791 14/50 (28%)
WD40 repeat 349..446 CDD:293791 19/102 (19%)
WD40 repeat 452..490 CDD:293791 12/39 (31%)
WD40 repeat 498..524 CDD:293791 5/25 (20%)
Dnai1NP_780347.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 119..165
WD40 321..679 CDD:225201 84/378 (22%)
WD40 repeat 336..382 CDD:293791 11/48 (23%)
WD40 <354..612 CDD:295369 64/280 (23%)
WD 1 382..422 7/39 (18%)
WD40 repeat 388..429 CDD:293791 8/40 (20%)
WD 2 431..474 14/42 (33%)
WD40 repeat 436..493 CDD:293791 15/56 (27%)
WD40 repeat 501..538 CDD:293791 10/37 (27%)
WD 3 539..579 8/59 (14%)
WD40 repeat 544..581 CDD:293791 7/56 (13%)
WD 4 581..621 14/40 (35%)
WD40 repeat 586..627 CDD:293791 12/40 (30%)
WD 5 629..668 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.