DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic4 and DNAI2

DIOPT Version :9

Sequence 1:NP_001368966.1 Gene:Sdic4 / 2768886 FlyBaseID:FBgn0053499 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001340096.1 Gene:DNAI2 / 64446 HGNCID:18744 Length:649 Species:Homo sapiens


Alignment Length:477 Identity:118/477 - (24%)
Similarity:205/477 - (42%) Gaps:87/477 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 THGLPTVKDVAPA-ITPLEIKKETEVKKEVNELSEEQKQMIILSENFQRFVVRAGRVIERALSEN 154
            |.|:..|:...|. :.|||:::....:|:|.:           .||:...:::.|.::|..:.:|
Human    71 TRGVNHVEGGWPKDVNPLELEQTIRFRKKVEK-----------DENYVNAIMQLGSIMEHCIKQN 124

  Fly   155 --VDIYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDW-------------STH 204
              :|||.:|....::.|..:|...|: ::| ||.|.:..| |..|.:.|             ...
Human   125 NAIDIYEEYFNDEEAMEVMEEDPSAK-TIN-VFRDPQEIK-RAATHLSWHPDGNRKLAVAYSCLD 186

  Fly   205 FPELVVG----SYHNNEESPNEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNP---NLI 262
            |....||    ||..:.|:||:|:       ...|.|:|            ....:|||   :::
Human   187 FQRAPVGMSSDSYIWDLENPNKPE-------LALKPSSP------------LVTLEFNPKDSHVL 232

  Fly   263 LGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLD 327
            |||.|:|||..||.|  |.:.:.......::|..|||....:.::......|.|:||::..|.:.
Human   233 LGGCYNGQIACWDTR--KGSLVAELSTIESSHRDPVYGTIWLQSKTGTECFSASTDGQVMWWDIR 295

  Fly   328 MLSQPQDTLEL----QQRQSKAIAITSMAFPANEINSLVMGSEDGYVYSASRHGLRSGVNEV--Y 386
            .:|:|.:.:.|    :::...|:...|:.|.:......::|:|.|.|.|.:|....|....|  :
Human   296 KMSEPTEVVILDITKKEQLENALGAISLEFESTLPTKFMVGTEQGIVISCNRKAKTSAEKIVCTF 360

  Fly   387 ERHLGPITGISTHYNQLSPDFGHLFLTS---SIKIWSLKLPISSCQFSVVSGINSNKPLYSFEDN 448
            ..|.|||..:     |.:|.:...|||.   :.:|||.....||..::              :.:
Human   361 PGHHGPIYAL-----QRNPFYPKNFLTVGDWTARIWSEDSRESSIMWT--------------KYH 406

  Fly   449 SDYMMDVAWSPVHPALFAAVDGSGRLDLWNLNQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIG 513
            ..|:.|.|||||.|.:|......|.||:|:...:...||.|:.|.. .||..:....:|..:..|
Human   407 MAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCD-EALFCLRVQDNGCLIACG 470

  Fly   514 DEAGKLYVYDVAENLAQPSRDE 535
            .:.|...:.:|:..|:...|:|
Human   471 SQLGTTTLLEVSPGLSTLQRNE 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic4NP_001368966.1 Dynein_IC2 23..51 CDD:402922
WD40 196..523 CDD:421866 87/355 (25%)
WD40 repeat 196..245 CDD:293791 14/65 (22%)
WD40 repeat 251..289 CDD:293791 14/40 (35%)
WD40 repeat 298..337 CDD:293791 9/38 (24%)
WD40 repeat 349..446 CDD:293791 24/101 (24%)
WD40 repeat 452..490 CDD:293791 14/37 (38%)
WD40 repeat 498..524 CDD:293791 4/25 (16%)
DNAI2NP_001340096.1 WD40 <166..494 CDD:225201 91/368 (25%)
WD40 repeat 166..215 CDD:293791 11/55 (20%)
WD40 repeat 220..259 CDD:293791 14/40 (35%)
WD40 repeat 267..307 CDD:293791 8/39 (21%)
WD40 repeat 314..361 CDD:293791 11/46 (24%)
WD40 repeat 367..403 CDD:293791 11/40 (28%)
WD40 repeat 410..435 CDD:293791 11/24 (46%)
WD40 repeat 455..489 CDD:293791 6/33 (18%)
WTX 479..>627 CDD:312801 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.