DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic4 and CG15701

DIOPT Version :9

Sequence 1:NP_001368966.1 Gene:Sdic4 / 2768886 FlyBaseID:FBgn0053499 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_611100.1 Gene:CG15701 / 36801 FlyBaseID:FBgn0034095 Length:1051 Species:Drosophila melanogaster


Alignment Length:432 Identity:74/432 - (17%)
Similarity:137/432 - (31%) Gaps:151/432 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 STGGGNGDVLAFDAQG---DDEESSLQNLGNGFTSKLPPGY-----LTHGLPTVKDVAPAITPLE 108
            |.|..|...:|...|.   |.|..:|:.......::.||.|     |:..:....|...:..|.:
  Fly   415 SYGKLNASQVATQTQSPHMDGECQTLEVHSRSSWTQHPPHYGGQFVLSCSVDAELDETWSKQPAD 479

  Fly   109 IKKETEVKK--EVNELSEEQKQMIILS--------ENFQRFVVRAGRVIERALS----------- 152
             :.|..:.:  :::.|.:.:.|.:...        |....|:.||||::...|.           
  Fly   480 -EYEASISRLEQLHRLEQARSQQLQQKRLAKSTDLERLNSFLHRAGRLMGLVLEGKTTAHGQGNS 543

  Fly   153 -ENVDIYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGSYHNN 216
             .||.:.|..:..              |.:.|:|                         ||..|.
  Fly   544 PRNVPLQTGLLNA--------------LPVRRIF-------------------------GSAGNG 569

  Fly   217 E------ESPNEPD-------GVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYS 268
            :      |.|.:.:       .::|||:.. ..|.|..:....:.|.....:....::::.|...
  Fly   570 QLVVTVHECPADSNVYKEDFASLLMVWSLA-NPSQPLRLLSTWAEVSRVALSAQAQDIVVAGLRD 633

  Fly   269 GQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSLDMLSQPQ 333
            |.:.:||.|                .||. ||.::              ||.|..:     :..|
  Fly   634 GSVAMWDLR----------------ETHS-YCSKL--------------DGHLTHF-----AATQ 662

  Fly   334 DTLELQQRQSKAIAITSMAFPANEINSLVMGSEDGYVYSASRHGLRSGVNEVYERHLGPITGIST 398
            ..:.:.::|.|            |:|::.:|:... |.|...|....||        ...:|:.|
  Fly   663 SVVPMPEQQDK------------EVNAMDLGAVVD-VRSFRSHLNAGGV--------AATSGLQT 706

  Fly   399 HYNQLSPDFGHLFLTSSIKIWSLKLPISSCQFSVVSGINSNK 440
            .|.::  .:..|..:..:.:|:|        ....|..|||:
  Fly   707 TYKEV--QYASLNDSGLLTMWTL--------VEGASSTNSNE 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic4NP_001368966.1 Dynein_IC2 23..51 CDD:402922
WD40 196..523 CDD:421866 44/258 (17%)
WD40 repeat 196..245 CDD:293791 10/61 (16%)
WD40 repeat 251..289 CDD:293791 5/37 (14%)
WD40 repeat 298..337 CDD:293791 6/38 (16%)
WD40 repeat 349..446 CDD:293791 18/92 (20%)
WD40 repeat 452..490 CDD:293791
WD40 repeat 498..524 CDD:293791
CG15701NP_611100.1 PTZ00108 <23..270 CDD:240271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.