DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic4 and CG10859

DIOPT Version :9

Sequence 1:NP_001368966.1 Gene:Sdic4 / 2768886 FlyBaseID:FBgn0053499 Length:554 Species:Drosophila melanogaster
Sequence 2:NP_001285898.1 Gene:CG10859 / 34756 FlyBaseID:FBgn0032520 Length:627 Species:Drosophila melanogaster


Alignment Length:489 Identity:99/489 - (20%)
Similarity:178/489 - (36%) Gaps:94/489 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 KEVNELSEE-----QKQMIILSENFQRFVVRAGRVIERAL---SEN--VDIYTDY-------IGG 164
            ||||.:.||     :|::    |....:.:...:::..|:   |.|  |:||.|:       :|.
  Fly    86 KEVNIMDEESTMRYRKKV----ERDDSWGIEVNQLMHAAMDISSANNAVNIYEDFFVDLPEDLGR 146

  Fly   165 GDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPELVVGSYHNN------------- 216
            |.|.:.....:|       ||:| .|..:|.:.:.:|..:.|...:..|.|.             
  Fly   147 GISMKIAARGTH-------VFHD-LWIPSRRLMTCEWLNNDPNQFLLFYSNRMSLTPDYTKQLNT 203

  Fly   217 -EESPNEPDGVVMVWNTKFKKSTPEDVFHCQS----AVMSTCFAKFNPNLILGGTYSGQIVLWDN 276
             .:..|:......:||.   ........|..|    .|...|..  :.:.::||...||:..|..
  Fly   204 LPDFGNDNPHAFYIWNL---DDATRPAAHYDSRRVVRVAKVCLR--DESYMVGGLQEGQVGFWLT 263

  Fly   277 RVQKRTPIQRTPLSAAAHTHPVYCLQMVGTQNAHNVISISSDGKLCSWSL--------DMLSQPQ 333
            ..| ..|....||. |.|......:..|.::......|.|.||.:..|..        ::|::| 
  Fly   264 ENQ-GGPKSMCPLE-ACHREATTAICWVHSKLNTEFYSGSLDGSIKYWDTRDLLMPVHEVLAEP- 325

  Fly   334 DTLELQQRQSKAIAITSMAFPANEINSLVMGSEDGYVYSASRHGL--RSGVNEVYERHLGPITGI 396
            |...:|.||. |..:|.:.|........:..::.||::..:|.|.  :..:...|:...|||..:
  Fly   326 DPQTVQNRQD-AHGVTFLEFEYTIPVRFIFCTDMGYLFVGNRKGTTPQDTIVAAYQLFAGPIRCV 389

  Fly   397 STHYNQLSPDFGHLFLTSS---IKIWSLKLPISSCQFSVVSGINSNKPLYSFEDNSDYMMDVAWS 458
                 ..:|.|...||...   ::|||.::              .|.|...:....:.::..|||
  Fly   390 -----MRNPFFVKNFLVVGDWRVRIWSEEV--------------KNCPSTFYFRRPNQLLSGAWS 435

  Fly   459 PVHPALFAAVDGSGRLDLWNLNQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYD 523
            ....:||...|..|.|:.|:|....:.|.  :.:....|:..:.:.|.|..:.:....|...:..
  Fly   436 TGRCSLFCIGDNMGNLEFWDLLMSHKRPI--LTIKYKYAVTHLVFKPDGTMLTVSLANGDCLMLR 498

  Fly   524 VAENLAQPSRDE----WSRFNTHLSEIKMNQSDE 553
            :.|.:...:..|    .|.|...:...|:.::.|
  Fly   499 LEEGMRSATNKEKSLMMSMFEREIQRCKLLEARE 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic4NP_001368966.1 Dynein_IC2 23..51 CDD:402922
WD40 196..523 CDD:421866 69/357 (19%)
WD40 repeat 196..245 CDD:293791 7/62 (11%)
WD40 repeat 251..289 CDD:293791 8/37 (22%)
WD40 repeat 298..337 CDD:293791 9/46 (20%)
WD40 repeat 349..446 CDD:293791 19/101 (19%)
WD40 repeat 452..490 CDD:293791 11/37 (30%)
WD40 repeat 498..524 CDD:293791 3/25 (12%)
CG10859NP_001285898.1 WD40 <245..310 CDD:295369 16/66 (24%)
WD40 261..>512 CDD:225201 56/275 (20%)
WD40 279..492 CDD:295369 47/235 (20%)
WD40 repeat 284..332 CDD:293791 9/48 (19%)
WD40 repeat 386..422 CDD:293791 10/54 (19%)
WD40 repeat 429..454 CDD:293791 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435288
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12442
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.