DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic2 and DYNC2I1

DIOPT Version :9

Sequence 1:NP_001285481.1 Gene:Sdic2 / 2768883 FlyBaseID:FBgn0053497 Length:543 Species:Drosophila melanogaster
Sequence 2:XP_006716104.1 Gene:DYNC2I1 / 55112 HGNCID:21862 Length:1069 Species:Homo sapiens


Alignment Length:427 Identity:96/427 - (22%)
Similarity:164/427 - (38%) Gaps:94/427 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 KNRCITSMDWSTHFPELVVGSYHNNEESPNEP--DG--VVMVWNTKFKKSTPEDVFHCQSAVMST 252
            :||.::|:..|....::|| |.|:..|....|  |.  |:.||:. ::.|.|:.|..|:|.|...
Human   643 QNRKVSSLHTSRVQRQMVV-SVHDLPEKSFVPLLDSKYVLCVWDI-WQPSGPQKVLICESQVTCC 705

  Fly   253 CFAKFNPNLILGGTYSGQIVLWDNR-------------------------------VQKRTPIQR 286
            |.:.....|:..||..|.:|:||.|                               |..|:|:|.
Human   706 CLSPLKAFLLFAGTAHGSVVVWDLREDSRLHYSVTLSDGFWTFRTATFSTDGILTSVNHRSPLQA 770

  Fly   287 T-PLSAAAHTHPVYCLQMVGTQN-----AHNVISISSDGKLCSWSL-------------DMLSQP 332
            . |:|.:.|....:.|....||.     :.::.|:...|.|..|.:             |:...|
Human   771 VEPISTSVHKKQSFVLSPFSTQEEMSGLSFHIASLDESGVLNVWVVVELPKADIAGSISDLGLMP 835

  Fly   333 QDTLELQQRQSKAIAI-TSMAFPANEI----------------NSVVMGSEDGYVYSASRHGLRS 380
            ...::|.  .|..|.: .|::...||.                |..::|::.|.:...:|..||.
Human   836 GGRVKLV--HSALIQLGDSLSHKGNEFWGTTQTLNVKFLPSDPNHFIIGTDMGLISHGTRQDLRV 898

  Fly   381 GVNEVYERHLGPITGISTHYNQLSPDFGH-LFLTSSIDWTIKLWSLKDTKPLYSFEDNSD--YVM 442
             ..::::.....|..:..:....|| ||. :||....|.:|:|..|....||..::.::|  .|.
Human   899 -APKLFKPQQHGIRPVKVNVIDFSP-FGEPIFLAGCSDGSIRLHQLSSAFPLLQWDSSTDSHAVT 961

  Fly   443 DVAWSPVHPALFAAVDGSGRLDLWNLNQDTEVPTA----------SIVVAGAPALNRVSWTPSGL 497
            .:.|||..||:|...|.:..:.:|:|.|....|.|          ::...|.|.....|:    |
Human   962 GLQWSPTRPAVFLVQDDTSNIYIWDLLQSDLGPVAKQQVSPNRLVAMAAVGEPEKAGGSF----L 1022

  Fly   498 HVCIGDEAGKLYVYDVAENLAQPSRDEWSRFNTHLSE 534
            .:.:...:|.:.:..:....|.|..||.:|....|.|
Human  1023 ALVLARASGSIDIQHLKRRWAAPEVDECNRLRLLLQE 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic2NP_001285481.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368
WD40 196..512 CDD:295369 87/399 (22%)
WD40 repeat 196..245 CDD:293791 15/52 (29%)
WD40 <224..523 CDD:225201 81/380 (21%)
WD40 repeat 251..289 CDD:293791 13/69 (19%)
WD40 repeat 298..337 CDD:293791 9/56 (16%)
WD40 repeat 349..435 CDD:293791 22/102 (22%)
WD40 repeat 441..479 CDD:293791 13/47 (28%)
WD40 repeat 487..513 CDD:293791 3/25 (12%)
DYNC2I1XP_006716104.1 WD40 630..1020 CDD:225201 86/382 (23%)
WD40 repeat 648..676 CDD:293791 8/28 (29%)
WD40 repeat 736..778 CDD:293791 6/41 (15%)
WD40 repeat 785..814 CDD:293791 6/28 (21%)
WD40 repeat 829..860 CDD:293791 7/32 (22%)
WD40 <915..987 CDD:295369 22/72 (31%)
WD40 repeat 916..952 CDD:293791 12/36 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.