DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic2 and Dnai1

DIOPT Version :9

Sequence 1:NP_001285481.1 Gene:Sdic2 / 2768883 FlyBaseID:FBgn0053497 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001019513.1 Gene:Dnai1 / 500442 RGDID:1565671 Length:705 Species:Rattus norvegicus


Alignment Length:450 Identity:105/450 - (23%)
Similarity:215/450 - (47%) Gaps:39/450 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LPTVKDVAPAITPLEIKKETEVKKEVNELSEEQKQMIILSENFQRFVVRAGRVIERALSENV--D 156
            |...|:.....||  :.|:|| |..:.:|:..:.|    |::..: |.:|.:::||.:::|.  |
  Rat   246 LEKTKEKEKTKTP--VAKKTE-KMAMRKLTSMESQ----SDDITK-VTQAAKIVERMVNQNTYDD 302

  Fly   157 IYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKNRCITSMDWSTHFPEL-VVGSYHNNEESP 220
            :..|:....|:.:...::....|.|.:...|:  :|...:|::.|:..:.:| .||  |.:.:..
  Rat   303 VAQDFKYYEDAADEYRDQEGTLLPLWKFQNDK--AKRLAVTALCWNPKYKDLFAVG--HGSYDFM 363

  Fly   221 NEPDGVVMVWNTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQ 285
            .:..|::::::.| ..|.||.:|..:|.:|.......:|.|::.|.|.|.:.:::.:.....|..
  Rat   364 KQSRGMLLLYSMK-NPSFPEYMFSSESGIMCLDMHMDHPYLVVVGYYDGNVAIYNLKKPHSQPCF 427

  Fly   286 RTPLSAAAHTHPVYCLQMVGTQNAHNV--ISISSDGKLCSWSL--------DM--LSQPQDTLEL 338
            |:...:..||.||:.::.......||:  .|:||||::.||:|        |:  |.....|.|:
  Rat   428 RSTSKSGKHTDPVWQVKWQKDDMDHNLNFFSVSSDGRIVSWTLVKSELVHIDVIKLKDEGSTTEI 492

  Fly   339 QQRQSKAIAITSMAFPAN-EINSV-VMGSEDGYVYSASRHGLRSGVNEVYERHLGPITGISTHYN 401
            .:...........||..: ||:.: ::|:|:|.:|..|: ...|...:.|:.|...:..:     
  Rat   493 PEGLQLHTVGCGTAFDFHKEIDYLFLVGTEEGKIYKCSK-SYSSQFLDTYDAHNMAVDAV----- 551

  Fly   402 QLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRLDLW 466
            ..:|....:|::.|.|||:|:|......|::.::.|: .|.||||:|....:||||...|:..::
  Rat   552 LWNPYHARVFISCSSDWTVKIWDHAIKTPMFIYDLNA-AVGDVAWAPYSSTVFAAVTTDGKAHVF 615

  Fly   467 NL--NQDTEVPTASIVVAGAPALNRVSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDE 524
            :|  |:...:....:|......:..|.:.|....:.:||:.|.:....::.||.:..:::
  Rat   616 DLAVNKYEAICNQPVVAKKKNKITHVQFNPIHPIIIVGDDRGHITCLKLSPNLRKMPKEK 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic2NP_001285481.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 15/71 (21%)
WD40 196..512 CDD:295369 80/332 (24%)
WD40 repeat 196..245 CDD:293791 12/49 (24%)
WD40 <224..523 CDD:225201 76/314 (24%)
WD40 repeat 251..289 CDD:293791 7/37 (19%)
WD40 repeat 298..337 CDD:293791 14/50 (28%)
WD40 repeat 349..435 CDD:293791 21/87 (24%)
WD40 repeat 441..479 CDD:293791 13/39 (33%)
WD40 repeat 487..513 CDD:293791 5/25 (20%)
Dnai1NP_001019513.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..169
WD40 325..683 CDD:225201 86/362 (24%)
WD40 repeat 340..386 CDD:293791 11/48 (23%)
WD40 <358..616 CDD:295369 66/265 (25%)
WD 1 386..426 7/39 (18%)
WD40 repeat 392..433 CDD:293791 8/40 (20%)
WD 2 435..478 14/42 (33%)
WD40 repeat 440..494 CDD:293791 15/53 (28%)
WD40 repeat 505..542 CDD:293791 10/37 (27%)
WD 3 543..583 10/44 (23%)
WD40 repeat 548..587 CDD:293791 9/43 (21%)
WD 4 585..625 14/40 (35%)
WD40 repeat 590..631 CDD:293791 13/40 (33%)
WD 5 633..672 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.