DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sdic2 and Dnai2

DIOPT Version :9

Sequence 1:NP_001285481.1 Gene:Sdic2 / 2768883 FlyBaseID:FBgn0053497 Length:543 Species:Drosophila melanogaster
Sequence 2:NP_001007727.1 Gene:Dnai2 / 360654 RGDID:1359602 Length:619 Species:Rattus norvegicus


Alignment Length:490 Identity:120/490 - (24%)
Similarity:211/490 - (43%) Gaps:89/490 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QGDDEESSLQNLGNGFTSKLPPGYLTHGLPTVKDVAPAITPLEIKKETEVKKEVNELSEEQKQMI 130
            :.:.|...::|.|        ..::..|.|  |||    .|.|:::....:|:|.:         
  Rat    61 EANTERFEMENCG--------VNHVEGGWP--KDV----NPQELEQTIRFRKKVEK--------- 102

  Fly   131 ILSENFQRFVVRAGRVIERALSEN--VDIYTDYIGGGDSEEANDERSHARLSLNRVFYDERWSKN 193
              .||:...|::.|.::|..:.:|  :|||.:|....::.|..:|...|: ::| ||.|.:..| 
  Rat   103 --DENYINAVMQLGSIMEHCIKQNNAIDIYEEYFDDEEAVEVTEEAPSAK-TIN-VFRDPQEIK- 162

  Fly   194 RCITSMDW-------------STHFPELVVGSYHNNE----ESPNEPDGVVMVWNTKFKKSTPED 241
            |..|.:.|             ...|....:|..|::.    |:||.|:       ...|.|:|  
  Rat   163 RTATHLSWHPDGNKKLAVAYSCLQFQRSPMGMSHDSYIWDLENPNRPE-------IALKPSSP-- 218

  Fly   242 VFHCQSAVMSTCFAKFNP---NLILGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCLQM 303
                      ....::||   :::|||.|:|||..||.|  |.:.:........:|..|||....
  Rat   219 ----------LITLEYNPKDSHVLLGGCYNGQIACWDTR--KGSLVAELSTIEFSHRDPVYGTIW 271

  Fly   304 VGTQNAHNVISISSDGKLCSWSLDMLSQPQDTLEL----QQRQSKAIAITSMAFPANEINSVVMG 364
            :.::......|.|:||::..|.:..:|:|.:.:.:    :::...|:...|:.|.:......::|
  Rat   272 LQSKTGTECFSASTDGQVMWWDIRKISEPTEVVIMDITRKEQLENALGAISLEFESTLPTKFMVG 336

  Fly   365 SEDGYVYSASRHGLRSGVNEV--YERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWS--L 425
            :|.|.|.|.:|.........|  :..|.|||..:     |.:|.:...|||.. ||..::||  .
  Rat   337 TEQGIVISCNRKAKTPAEKIVCTFSGHHGPIYAL-----QRNPFYPKNFLTVG-DWAARIWSEES 395

  Fly   426 KDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRLDLWNLNQDTEVPTASIVVAGAPAL-NR 489
            :::..::: ..:..|:.|.|||||.||:|......|.||:|:|......|..|:.|...|.. .|
  Rat   396 RESSIMWT-RYHMAYLSDGAWSPVRPAVFFTTKMDGTLDIWDLVFKQCDPALSLKVCDDPLFCLR 459

  Fly   490 VSWTPSGLHVCIGDEAGKLYVYDVAENLAQPSRDE 524
            |..|  |..:..|.|.|...:.:|:.:|:...|:|
  Rat   460 VQDT--GCLIACGSELGTTTLLEVSSSLSTLQRNE 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sdic2NP_001285481.1 Dynein_IC2 23..51 CDD:288403
NtpH 108..>178 CDD:225368 15/71 (21%)
WD40 196..512 CDD:295369 85/344 (25%)
WD40 repeat 196..245 CDD:293791 12/65 (18%)
WD40 <224..523 CDD:225201 78/310 (25%)
WD40 repeat 251..289 CDD:293791 13/40 (33%)
WD40 repeat 298..337 CDD:293791 9/38 (24%)
WD40 repeat 349..435 CDD:293791 22/89 (25%)
WD40 repeat 441..479 CDD:293791 15/37 (41%)
WD40 repeat 487..513 CDD:293791 7/26 (27%)
Dnai2NP_001007727.1 WD40 repeat 165..212 CDD:293791 9/53 (17%)
WD40 <166..489 CDD:225201 87/352 (25%)
WD40 166..472 CDD:295369 83/335 (25%)
WD 1 214..254 16/53 (30%)
WD40 repeat 220..259 CDD:293791 13/40 (33%)
WD 2 261..302 11/40 (28%)
WD40 repeat 266..361 CDD:293791 19/94 (20%)
WD40 repeat 318..347 CDD:293791 7/28 (25%)
WD 3 362..401 13/44 (30%)
WD40 repeat 367..403 CDD:293791 10/41 (24%)
WD 4 405..445 15/39 (38%)
WD40 repeat 410..435 CDD:293791 12/24 (50%)
WD 5 450..489 11/40 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 566..619
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.