DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rai1 and AT4G17620

DIOPT Version :9

Sequence 1:NP_996492.1 Gene:Rai1 / 2768882 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001031654.1 Gene:AT4G17620 / 827482 AraportID:AT4G17620 Length:544 Species:Arabidopsis thaliana


Alignment Length:299 Identity:82/299 - (27%)
Similarity:123/299 - (41%) Gaps:73/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DLNGGIEDVIRKPVENGKRDLEIMLTYIKQHQKELLRQSSSD------ARNLRLDS-DFVTLRGI 123
            |||.|.:..|.|                    |:|..:...|      |:|:.||: .|||.|..
plant   255 DLNQGYDTFIEK--------------------KDLGSEGFGDLLGSIRAKNISLDNIHFVTFRNN 299

  Fly   124 LRQIMCLQYD-NRSFRVKATLLNGNVYMCKEETPEQQLENANMSRAQRVMCSWGFKFEQYLTS-- 185
            |.:|:...|: :..:.:.....||.:|:...:.||:.     .|...|..|.||:.||...|.  
plant   300 LNKILGAAYNRHEPWEMGVHKRNGTIYLDVHKLPERP-----QSDLDRRRCYWGYCFESLATEDP 359

  Fly   186 AQAQGKPVTNVPVNEAEEFMGVYRTNLAGILMLYGAELDCVDSKEPVDFKDCRVLDSLK--FVEL 248
            .:|.|:.:.:|..|  .||..|.||.|....::.|||:||           |.|.|..|  :|||
plant   360 GRAYGEEIHHVDAN--VEFCSVVRTKLGAHRVMMGAEMDC-----------CDVSDKGKRFYVEL 411

  Fly   249 KTSVFNMNPHQIRTFKSFKSANWWSQSFLVGITTLYVGLRDTKGMLQRIDEI---DVATLARNKP 310
            ||: ..::...:..|:..|...:|.|||:.|:..:.||.||..|.|.|.:.:   |:|..||.|.
plant   412 KTT-RELDDRTVDRFEREKLLKFWIQSFVAGVPYIVVGFRDDGGRLVRTERLTTRDIAHRARLKN 475

  Fly   311 -WSA--------SAMAW----------YLEQFLRNLKKL 330
             |..        ..:.|          |:.||:....:|
plant   476 YWQVRVCLAFADEVLCWLYGTVKENEDYILQFVHPFMRL 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rai1NP_996492.1 RAI1 224..296 CDD:285815 24/73 (33%)
AT4G17620NP_001031654.1 RAI1 395..458 CDD:285815 24/74 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1982
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38061
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1034620at2759
OrthoFinder 1 1.000 - - FOG0004964
OrthoInspector 1 1.000 - - oto2825
orthoMCL 1 0.900 - - OOG6_104243
Panther 1 1.100 - - LDO PTHR12395
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3502
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.