DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rai1 and C37H5.14

DIOPT Version :9

Sequence 1:NP_996492.1 Gene:Rai1 / 2768882 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_001300056.1 Gene:C37H5.14 / 6418705 WormBaseID:WBGene00045308 Length:322 Species:Caenorhabditis elegans


Alignment Length:312 Identity:65/312 - (20%)
Similarity:113/312 - (36%) Gaps:95/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ENGKRDLEIMLTYIKQHQ------KELLRQSSSDARNLRLDSDFVTLRGILRQIMCLQYDNRSFR 138
            |:|...:|.:|.||.:..      ||:            :::|.|..||:||.:...:|......
 Worm    54 EHGGERIESILAYIMKTARIGIPLKEM------------IEADIVCRRGLLRNLSINKYTGHYIN 106

  Fly   139 VKATLLNGNVYMCKEE----TPEQQLENANMSRAQRVMCSWGFKFEQYLTSAQ-----AQGKPVT 194
            ..|....|.:::|:::    .|:         :.:|.|.. ..|||..:|..|     |..|..|
 Worm   107 FYAVRHRGVIFLCEDKDFGGAPD---------KLRRAMYH-TLKFENVMTVPQSRDITASRKEAT 161

  Fly   195 NVPVNEAEEFMGVYRTNLAGILMLYGAELDCVD-SKEPVDFKDCRVLDSLKFVELKTSVFNMNPH 258
            .:.:....|..|.     ..|.:.|.|::||:| ...||:||...       ..|:|. ::.|  
 Worm   162 KMVIRGCLEKEGA-----ESIRLFYAADIDCLDIYGSPVEFKSIS-------KPLETG-WDKN-- 211

  Fly   259 QIRTFKSFKSANWWSQSFLVGITTLYVG------LRDTKGMLQRIDEIDVATL--ARNKPWSASA 315
                    ::..|:.|.|...:.|:.||      ||..:...:.|..::|...  .||..|:..:
 Worm   212 --------RTMAWYMQCFFASVNTIVVGERQRSRLRTVRHYRKSIKTMNVEAFYTHRNHSWTRES 268

  Fly   316 MAWYLEQFLRNLKKLLVNINDPFAVVQVTFLNKHAS-------YEVLRGPEH 360
            .   :||....|                :|:..|.|       :.|:.|..:
 Worm   269 C---IEQLYGTL----------------SFVKHHMSLDGMALKFSVINGTNY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rai1NP_996492.1 RAI1 224..296 CDD:285815 18/78 (23%)
C37H5.14NP_001300056.1 RAI1 185..240 CDD:370037 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1034620at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12395
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.