DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rai1 and Y47H10A.3

DIOPT Version :9

Sequence 1:NP_996492.1 Gene:Rai1 / 2768882 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_493054.2 Gene:Y47H10A.3 / 190008 WormBaseID:WBGene00012959 Length:333 Species:Caenorhabditis elegans


Alignment Length:318 Identity:61/318 - (19%)
Similarity:119/318 - (37%) Gaps:86/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 HKLGAMYNTP--FPSISRPKCIGVCSINASREFVDDASCASYLAGQPWPPLPFDLNGGIEDVIRK 77
            |:.|.|:.||  .|......|:                 ..:.:.:.:|.:..::          
 Worm    15 HRDGDMHVTPGLLPKKLNTTCL-----------------KPFKSKEEFPNMNIEV---------- 52

  Fly    78 PVENGKRDL--EIMLTYIKQHQKELLRQSSSDARNLRLDSDFVTLRGILRQIMCLQYDNRSFRVK 140
             :::||.:|  |.:|.|:  ||...|         ..:..||||    .:|::.:...:....:.
 Worm    53 -LDSGKGELMMESLLDYV--HQTNCL---------TTVKPDFVT----NKQLLVVIAGSGPAVIF 101

  Fly   141 ATLLNGNVYMCKEETPEQQLENANMSRAQRVMCSWGFKFEQYLTSAQAQGKPVTNVPVNEAEEFM 205
            |...||.:::.|  ..|:|....|.          |..||.:.|..:.:.:...:..|.:|....
 Worm   102 AYQRNGIIFILK--YTEEQTSTINK----------GGVFEHFCTKTRDEEQLEPDETVRKAVFTA 154

  Fly   206 GVYRTNLAGILMLYGAELDCVDSKEPVDFKDCRVLDSLKFVELKTSVFNMNPHQIRTFKSFKSAN 270
            .:.|.|.....::|..::|.:|.:|           :.:..|||.....:|.:    |...:|..
 Worm   155 EIPRGNGDTFKVMYSGQIDAIDDEE-----------NRQHYELKVFSGGLNEY----FWKKRSLQ 204

  Fly   271 WWSQSFLVGITTLYVGLRDTKGMLQRIDEIDVATLARNK--PWSASAMAWYLEQFLRN 326
            .:.|:|...:..|.:|.|  .|:.:|    |..|:..|.  |:|    .:|:::..|:
 Worm   205 TYWQAFFGNVPVLIIGSR--TGLYER----DPKTMPPNSWPPFS----VYYVQKLKRD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rai1NP_996492.1 RAI1 224..296 CDD:285815 15/71 (21%)
Y47H10A.3NP_493054.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12395
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.