DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rai1 and M01G12.9

DIOPT Version :10

Sequence 1:NP_996492.1 Gene:Rai1 / 2768882 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_493059.2 Gene:M01G12.9 / 187385 WormBaseID:WBGene00010822 Length:469 Species:Caenorhabditis elegans


Alignment Length:242 Identity:59/242 - (24%)
Similarity:92/242 - (38%) Gaps:53/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KPVENGKRDLEIMLTYIKQHQKELLRQSSSDARNLRLDSDFVTLRGILRQIMCLQYDNRSFRVKA 141
            |..:.|::.:|.||.|||  ||....:|.         .:||..|.::..|.. .....:|.|..
 Worm    52 KDTQGGEKQMESMLAYIK--QKGWAGESK---------PNFVMNRNVIGAIPS-STGVENFIVFK 104

  Fly   142 TLLNGNVYMCKEETPE---QQLENANMSRAQRVMCSWGFKFEQYLTSAQAQGKPVTNVPVNEAEE 203
            |    |......:||:   |:.|...|...:.::  :|..||.:.|....:..| ||..|.:|..
 Worm   105 T----NDVQVIVKTPKEKGQESEGNQMEPWKSLI--YGVNFEHHCTKTANEPLP-TNDAVTKAVL 162

  Fly   204 FMGVYRT----NLAGILMLYGAELDCVDSKEPVDFKDCRVLDSLKFVELKTSVFNMNPHQIRTFK 264
            ...|.||    |.:...:||.|::|.:|.|.             :..|:|.....:..:.:.   
 Worm   163 KAHVPRTQEGSNNSSYSILYSAQIDGIDDKR-------------QHYEMKVLNGGLTKYHLE--- 211

  Fly   265 SFKSANW--WSQSFLVGITTLYVGLRDTKGMLQRIDEIDVATLARNK 309
              .|:.|  | ||......||.||.|..|      .:.|..||.:.:
 Worm   212 --NSSCWFYW-QSVFGNCNTLIVGSRTGK------QDQDPKTLTKTR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rai1NP_996492.1 RAI1 224..296 CDD:462550 16/73 (22%)
M01G12.9NP_493059.2 MSCRAMM_ClfA <257..>371 CDD:468110
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.