DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rai1 and M01G12.9

DIOPT Version :9

Sequence 1:NP_996492.1 Gene:Rai1 / 2768882 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_493059.2 Gene:M01G12.9 / 187385 WormBaseID:WBGene00010822 Length:469 Species:Caenorhabditis elegans


Alignment Length:242 Identity:59/242 - (24%)
Similarity:92/242 - (38%) Gaps:53/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KPVENGKRDLEIMLTYIKQHQKELLRQSSSDARNLRLDSDFVTLRGILRQIMCLQYDNRSFRVKA 141
            |..:.|::.:|.||.|||  ||....:|.         .:||..|.::..|.. .....:|.|..
 Worm    52 KDTQGGEKQMESMLAYIK--QKGWAGESK---------PNFVMNRNVIGAIPS-STGVENFIVFK 104

  Fly   142 TLLNGNVYMCKEETPE---QQLENANMSRAQRVMCSWGFKFEQYLTSAQAQGKPVTNVPVNEAEE 203
            |    |......:||:   |:.|...|...:.::  :|..||.:.|....:..| ||..|.:|..
 Worm   105 T----NDVQVIVKTPKEKGQESEGNQMEPWKSLI--YGVNFEHHCTKTANEPLP-TNDAVTKAVL 162

  Fly   204 FMGVYRT----NLAGILMLYGAELDCVDSKEPVDFKDCRVLDSLKFVELKTSVFNMNPHQIRTFK 264
            ...|.||    |.:...:||.|::|.:|.|.             :..|:|.....:..:.:.   
 Worm   163 KAHVPRTQEGSNNSSYSILYSAQIDGIDDKR-------------QHYEMKVLNGGLTKYHLE--- 211

  Fly   265 SFKSANW--WSQSFLVGITTLYVGLRDTKGMLQRIDEIDVATLARNK 309
              .|:.|  | ||......||.||.|..|      .:.|..||.:.:
 Worm   212 --NSSCWFYW-QSVFGNCNTLIVGSRTGK------QDQDPKTLTKTR 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rai1NP_996492.1 RAI1 224..296 CDD:285815 16/73 (22%)
M01G12.9NP_493059.2 CTD 294..355 CDD:289577
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12395
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.