DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rai1 and F07H5.10

DIOPT Version :9

Sequence 1:NP_996492.1 Gene:Rai1 / 2768882 FlyBaseID:FBgn0030793 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_495876.1 Gene:F07H5.10 / 174408 WormBaseID:WBGene00008561 Length:334 Species:Caenorhabditis elegans


Alignment Length:302 Identity:58/302 - (19%)
Similarity:98/302 - (32%) Gaps:91/302 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PPLPFDLNGGIEDVIRKPVEN---------------------------GKRDLEIML-------- 90
            ||.|:| |.....|..|||.|                           .:|::.|.:        
 Worm     4 PPRPYD-NRPPTGVRAKPVINLNIEYTSCNDSVAPACSTRPMLIENMINQRNVNINVLEGYDPKS 67

  Fly    91 -TYIKQHQKELLRQSSSDARNL------------RLDSDFVTLRGILRQIMCLQYDNRSFRVKAT 142
             :.|.||....|.:..|..|.|            .|.:.|:..|.:|..|..:....:...:.|.
 Worm    68 KSVINQHSIYHLYEFESKTRFLDRIPRPRVSRFTELKTRFLCCRYVLCAIDDVMQKQKPMELMAI 132

  Fly   143 LLNGNVYMCKEETPEQQLENANMSRAQRVMCSWGFKFEQYLTSAQAQ------GKPVTNVPVNEA 201
            .|||::|:...::.:.|.:......|     ..|..|...:|....|      ...|..:.:...
 Worm   133 RLNGDIYIGANKSMDLQTDKKTQEAA-----FGGLNFAMKVTRESDQKILKKHHSVVKQLRIENT 192

  Fly   202 EE--FMGVYRTNLAGILMLYGAELDCVDSKEPVDFKDCRVLDSL-KFVELKTSVFNMNPHQIRTF 263
            ..  .|.::.:::|                        |..|.. ..||||| |.:....:::..
 Worm   193 RNSMSMSIFVSSVA------------------------RAFDQRGNVVELKT-VGSKVMGKVQNL 232

  Fly   264 KSFKSANWWSQSFLVGITTLYVGLRDTKGMLQRIDEIDVATL 305
            ...|:.:||.::.|.|...:..|||...   .:::||..|.|
 Worm   233 SRLKARDWWLRALLSGADRIVYGLRMDN---MKVNEIHEAQL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rai1NP_996492.1 RAI1 224..296 CDD:285815 16/72 (22%)
F07H5.10NP_495876.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1982
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12395
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.