DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9132 and CAF16

DIOPT Version :9

Sequence 1:NP_996490.1 Gene:CG9132 / 2768881 FlyBaseID:FBgn0030791 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_116625.1 Gene:CAF16 / 850516 SGDID:S000001866 Length:289 Species:Saccharomyces cerevisiae


Alignment Length:70 Identity:19/70 - (27%)
Similarity:31/70 - (44%) Gaps:15/70 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DWNLKEPTWTGRMRLV---AKGTAVVLKLEDK----TSGALFANCPIDTYPGVAI------EAVS 82
            |.||:.| |..|..:|   ..|.:.:|||...    ..|.:..| .:|.:..:::      |:|.
Yeast    26 DINLQIP-WNTRSLVVGANGAGKSTLLKLLSGKHLCLDGKILVN-GLDPFSPLSMNQVDDDESVE 88

  Fly    83 DSSRY 87
            ||:.|
Yeast    89 DSTNY 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9132NP_996490.1 DUF1681 3..157 CDD:285210 19/70 (27%)
CAF16NP_116625.1 COG4586 1..289 CDD:226952 19/70 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345155
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.