powered by:
Protein Alignment CG9132 and CAF16
DIOPT Version :9
Sequence 1: | NP_996490.1 |
Gene: | CG9132 / 2768881 |
FlyBaseID: | FBgn0030791 |
Length: | 246 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_116625.1 |
Gene: | CAF16 / 850516 |
SGDID: | S000001866 |
Length: | 289 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 70 |
Identity: | 19/70 - (27%) |
Similarity: | 31/70 - (44%) |
Gaps: | 15/70 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 31 DWNLKEPTWTGRMRLV---AKGTAVVLKLEDK----TSGALFANCPIDTYPGVAI------EAVS 82
|.||:.| |..|..:| ..|.:.:|||... ..|.:..| .:|.:..::: |:|.
Yeast 26 DINLQIP-WNTRSLVVGANGAGKSTLLKLLSGKHLCLDGKILVN-GLDPFSPLSMNQVDDDESVE 88
Fly 83 DSSRY 87
||:.|
Yeast 89 DSTNY 93
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C157345155 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.