DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9132 and ABCI18

DIOPT Version :9

Sequence 1:NP_996490.1 Gene:CG9132 / 2768881 FlyBaseID:FBgn0030791 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_563693.1 Gene:ABCI18 / 839378 AraportID:AT1G03900 Length:272 Species:Arabidopsis thaliana


Alignment Length:263 Identity:93/263 - (35%)
Similarity:141/263 - (53%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YESVLIVKPEVFIYKIPPRASNRGYRAGDWNLKEPTWTGRMRLVAKGTAVVLKLEDKTSGALFAN 67
            :|..|:|..||.:||||||.::.||:.|:|...:..|:||:|:|:......::|||..||.|||.
plant    12 FEHTLLVVREVSVYKIPPRTTSGGYKCGEWLQSDKIWSGRLRVVSCKDRCEIRLEDSNSGDLFAA 76

  Fly    68 CPIDTYPG---VAIEAVSDSSRYFVIRVQDDNGRSAFLGLGFGDRSDSFDLNVALQDHFKWVKNQ 129
            |.:|  ||   .::|...|||||||:|:.|..|:.||:||||.:|:::||.||||.||.|:|:.:
plant    77 CFVD--PGRRENSVEPSLDSSRYFVLRIDDGRGKYAFIGLGFAERNEAFDFNVALSDHEKYVRRE 139

  Fly   130 EQIEK-EKTEPKQELDL------GFKEGETIKINMR---ITKKDGSEGSSRTGKNKGSSGVLPPP 184
            ::.|. |.:|....:|:      ..||||||:||::   .|...|...::.:|..|.....|.||
plant   140 KEKETGETSESDNHIDIHPAVNHRLKEGETIRINVKPKPTTNGTGMLSAALSGTGKPKPLALAPP 204

  Fly   185 PGGLG----KIAPPPAAAAANTTVRQSPGVSPAHRPAAGGSEWTDY--ASAGGNQGQQNSANANW 243
            |...|    .:.|||....|:.........|..:.|.:..|:....  ::||....:...|.:.|
plant   205 PKAAGVTRSPLPPPPNDPVASRIASDGCKESRRNEPLSDLSQLKKNLPSTAGSGSSKSTGAASGW 269

  Fly   244 VQF 246
            ..|
plant   270 AAF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9132NP_996490.1 DUF1681 3..157 CDD:285210 71/163 (44%)
ABCI18NP_563693.1 DUF1681 12..175 CDD:400335 72/164 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 136 1.000 Domainoid score I1607
eggNOG 1 0.900 - - E1_KOG2500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I1698
OMA 1 1.010 - - QHG55046
OrthoDB 1 1.010 - - D1605812at2759
OrthoFinder 1 1.000 - - FOG0003085
OrthoInspector 1 1.000 - - oto3166
orthoMCL 1 0.900 - - OOG6_101944
Panther 1 1.100 - - O PTHR12847
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2448
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.