DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9132 and AT3G58600

DIOPT Version :9

Sequence 1:NP_996490.1 Gene:CG9132 / 2768881 FlyBaseID:FBgn0030791 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_567071.1 Gene:AT3G58600 / 825029 AraportID:AT3G58600 Length:302 Species:Arabidopsis thaliana


Alignment Length:251 Identity:84/251 - (33%)
Similarity:126/251 - (50%) Gaps:48/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESVLIVKPEVFIYKIPPRASNRGYRAGDWNLKEPTWTGRMRLVAKGTAVVLKLEDKTSGALFANC 68
            |..|...||.::|.||||.:...|||.:|::.:..|.|.:::|:||...::||.|||:|.|:|..
plant    33 EIALFQVPECYVYLIPPRKTAASYRADEWDVNKWAWEGALKVVSKGEECIIKLVDKTTGELYAQA 97

  Fly    69 PI---DTYPGVAIEAVSDSSRYFVIRVQ---DDNGRSAFLGLGFGDRSDSFDLNVALQDHFKWVK 127
            .:   :.:|   :|||.|||||||:||:   |...|.||:||||.:|::::|...||.||.|:  
plant    98 FLREGELHP---VEAVIDSSRYFVLRVEEKIDGRVRHAFIGLGFRERTEAYDFQAALHDHMKY-- 157

  Fly   128 NQEQIEKEKTEPKQE--------LDLGFKEGETIKINMRITKKDGSEGSSRTGKNKGS------- 177
                :.|:||..:.|        :|...||||||.:.:: .:.|....|....|:.|:       
plant   158 ----LNKKKTAEEMEQHYQNTSSVDYSLKEGETIVLQLK-NRSDKDSKSKTVEKSLGNLSLEDKG 217

  Fly   178 --------SGVLPPPPGGLGKIAPPPAAAAANTTVRQSPGVSPAHRPAAGGSEWTD 225
                    |.:|||         |||...:..||.::||...|........||..|
plant   218 KSIETTIPSIILPP---------PPPGPLSPVTTAQKSPSSLPPSLSLQRSSEQQD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9132NP_996490.1 DUF1681 3..157 CDD:285210 65/166 (39%)
AT3G58600NP_567071.1 DUF1681 32..192 CDD:400335 65/167 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605812at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101944
Panther 1 1.100 - - LDO PTHR12847
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.