DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9132 and NECAP2

DIOPT Version :9

Sequence 1:NP_996490.1 Gene:CG9132 / 2768881 FlyBaseID:FBgn0030791 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001138749.1 Gene:NECAP2 / 55707 HGNCID:25528 Length:273 Species:Homo sapiens


Alignment Length:243 Identity:125/243 - (51%)
Similarity:166/243 - (68%) Gaps:15/243 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YESVLIVKPEVFIYKIPPRASNRGYRAGDWNLKEPTWTGRMRLVAKGTAVVLKLEDKTSGALFAN 67
            |||||.|||:|.:|:|||||:||||||.:|.|.:|:|:||:|:.|||....:||||:|||.|||.
Human     6 YESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQ 70

  Fly    68 CPIDTYPGVAIEAVSDSSRYFVIRVQDDNGRSAFLGLGFGDRSDSFDLNVALQDHFKWVKNQEQI 132
            .|:|.:||.|:|:|:|||||||||::|.|||.||:|:|||||.|:||.||||||||||||.|.:.
Human    71 APVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEF 135

  Fly   133 EKEKTEPKQ--ELDLGFKEGETIKINM-RITKKDGSEGSSRT-GKNKGSSGVLPPPPGG-LGKIA 192
            .|:...|.|  :||||||||:|||:|: .:.||:|:.|:.|. ..:.|...:||||||| ...:.
Human   136 AKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLI 200

  Fly   193 PPPAAAAANTTVRQSPGVSPAHRPAAGGSEWTDYASAGGNQGQQNSAN 240
            |||....|.......|.|:|:          :|...|..:|.|..|::
Human   201 PPPGEQLAVGGSLVQPAVAPS----------SDQLPARPSQAQAGSSS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9132NP_996490.1 DUF1681 3..157 CDD:285210 99/155 (64%)
NECAP2NP_001138749.1 DUF1681 6..162 CDD:285210 99/155 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..194 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154582
Domainoid 1 1.000 223 1.000 Domainoid score I2582
eggNOG 1 0.900 - - E1_KOG2500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 262 1.000 Inparanoid score I3098
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55046
OrthoDB 1 1.010 - - D1605812at2759
OrthoFinder 1 1.000 - - FOG0003085
OrthoInspector 1 1.000 - - otm41544
orthoMCL 1 0.900 - - OOG6_101944
Panther 1 1.100 - - LDO PTHR12847
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4289
SonicParanoid 1 1.000 - - X2448
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.