DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9132 and NECAP2

DIOPT Version :10

Sequence 1:NP_996490.1 Gene:CG9132 / 2768881 FlyBaseID:FBgn0030791 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001138749.1 Gene:NECAP2 / 55707 HGNCID:25528 Length:273 Species:Homo sapiens


Alignment Length:266 Identity:54/266 - (20%)
Similarity:92/266 - (34%) Gaps:96/266 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RCECRITNLTGE-TLEA------------APEYLKK-NAIRWSSAAQIYEELKNPGHFQLCHVEK 59
            ||:.|:....|: .|:|            :.|.|:. |...|..||     |:.     ||    
Human   200 RCQGRMRKHVGDLCLQAGMLQDALVHYHMSVELLRSVNDFLWLGAA-----LEG-----LC---- 250

  Fly    60 RYKKNKSKSQYHSPERSPAGTPHHHRRLSHNHLAYGGSMSELNCTQSSVP---MSLHKVSSINRS 121
                 .:...||    .|.||              ||.........||:|   .:.|:..::..:
Human   251 -----SASVIYH----YPGGT--------------GGKTGARRLQGSSLPSEAANRHRPGALTTN 292

  Fly   122 AGTNP--ASRGGESS---------------------------LELEA-IAAVHELSFAVQSISVS 156
             |.||  ::..|.:.                           :|||| :.||..|:...:.:..|
Human   293 -GINPDTSTEIGRAKNCLSPEDIIDKYKEAISYYSKYKNAGVIELEACVKAVRVLAIQKRGMEAS 356

  Fly   157 EMLPRTPDLIFVNVTTLEAQPYCLELTLKGWRITSLRSDCMVGDFTRLELFTKYYDSLYLLMDDI 221
            |.|   .:.:::|:..|..     |..::.:.|.|...: ::| |.|...|.|...::..:...|
Human   357 EFL---QNAVYINLRQLSE-----EEKIQRYSILSELYE-LIG-FHRKSAFFKRVAAMQCVAPSI 411

  Fly   222 S-PGYR 226
            : ||:|
Human   412 AEPGWR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9132NP_996490.1 DUF1681 3..157 CDD:462320 37/194 (19%)
NECAP2NP_001138749.1 DUF1681 6..162 CDD:462320
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..194
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.