DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9132 and Necap1

DIOPT Version :9

Sequence 1:NP_996490.1 Gene:CG9132 / 2768881 FlyBaseID:FBgn0030791 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001025090.1 Gene:Necap1 / 312694 RGDID:1306053 Length:277 Species:Rattus norvegicus


Alignment Length:274 Identity:134/274 - (48%)
Similarity:174/274 - (63%) Gaps:29/274 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEYESVLIVKPEVFIYKIPPRASNRGYRAGDWNLKEPTWTGRMRLVAKGTAVVLKLEDKTSGALF 65
            :||||||.|||:|.:|:||||||||||||.||.|.:|.||||:|:.:||....:|||||.||.||
  Rat     5 LEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKLEDKVSGELF 69

  Fly    66 ANCPIDTYPGVAIEAVSDSSRYFVIRVQDDNGRSAFLGLGFGDRSDSFDLNVALQDHFKWVKNQE 130
            |..|::.|||:|:|.|:|||||||||:||..|||||:|:||.||.|:||.||:|||||||||.:.
  Rat    70 AQAPVEQYPGIAVETVADSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQET 134

  Fly   131 QIEKEKTE--PKQELDLGFKEGETIKINM-RITKKDGSEGSSRTGKNKGSSGVLPPPPGGLGKIA 192
            :|.||..|  .:.:||||||||:|||::: .||.|.|.....|.....|.| :|||||||...|.
  Rat   135 EISKESQEMDSRPKLDLGFKEGQTIKLSIGNITAKKGGTSKPRASGTGGLS-LLPPPPGGKVTIP 198

  Fly   193 PPPAAAAANTTVRQS------------------------PGVSPAHRPAAGGSE-WTDYASAGGN 232
            ||.::.|.:..|...                        |..:||..||:..:: |.|:::|..:
  Rat   199 PPSSSVAISNHVTPPPIPKSNHGSNDSDILLDLDSPAPVPTSAPAPAPASTSNDLWGDFSTASSS 263

  Fly   233 QGQQNSANANWVQF 246
            ...|....:|||||
  Rat   264 VPNQAPQPSNWVQF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9132NP_996490.1 DUF1681 3..157 CDD:285210 100/155 (65%)
Necap1NP_001025090.1 DUF1681 7..164 CDD:285210 100/156 (64%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..277 31/113 (27%)
WXXF motif 1 254..257 1/2 (50%)
WXXF motif 2 274..277 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348326
Domainoid 1 1.000 225 1.000 Domainoid score I2452
eggNOG 1 0.900 - - E1_KOG2500
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H22902
Inparanoid 1 1.050 265 1.000 Inparanoid score I2980
OMA 1 1.010 - - QHG55046
OrthoDB 1 1.010 - - D1605812at2759
OrthoFinder 1 1.000 - - FOG0003085
OrthoInspector 1 1.000 - - otm45667
orthoMCL 1 0.900 - - OOG6_101944
Panther 1 1.100 - - O PTHR12847
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2448
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.