DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9132 and Necap2

DIOPT Version :9

Sequence 1:NP_996490.1 Gene:CG9132 / 2768881 FlyBaseID:FBgn0030791 Length:246 Species:Drosophila melanogaster
Sequence 2:XP_006239241.1 Gene:Necap2 / 298598 RGDID:735063 Length:263 Species:Rattus norvegicus


Alignment Length:259 Identity:133/259 - (51%)
Similarity:178/259 - (68%) Gaps:14/259 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYESVLIVKPEVFIYKIPPRASNRGYRAGDWNLKEPTWTGRMRLVAKGTAVVLKLEDKTSGALFA 66
            ||||||.|||||.:|:|||||:||||||.:|.|.:|:|:||:|:.|||....:||||:|||.|||
  Rat     5 EYESVLCVKPEVHVYRIPPRATNRGYRASEWQLDQPSWSGRLRITAKGKVAYIKLEDRTSGELFA 69

  Fly    67 NCPIDTYPGVAIEAVSDSSRYFVIRVQDDNGRSAFLGLGFGDRSDSFDLNVALQDHFKWVKNQEQ 131
            ..|:|.:||.|:|:|:|||||||||::|.|||.||:|:|||||.|:||.||||||||||||.|.:
  Rat    70 QAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCE 134

  Fly   132 IEKEKTEPKQ--ELDLGFKEGETIKINM-RITKKDGSEGSSRT-GKNKGSSGVLPPPPGG-LGKI 191
            ..|:...|.:  :||||||||:|||||: .:.||:|:.|:.|| ..:.|...:||||||| :..:
  Rat   135 FAKQAQNPDEGPKLDLGFKEGQTIKINIANMRKKEGAAGAPRTRPASAGGLSLLPPPPGGKMSTL 199

  Fly   192 APPPAAAAANTTVRQ----SPGVS---PAHRPAAGGSE--WTDYASAGGNQGQQNSANANWVQF 246
            .||.....:..::.|    |.|.:   |..:|||..:.  |.|:..:.|:...|:.....||||
  Rat   200 IPPSGEQFSGGSLVQPVSGSGGATELWPQSKPAAAATADIWGDFTKSTGSPSSQSQPGTGWVQF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9132NP_996490.1 DUF1681 3..157 CDD:285210 100/155 (65%)
Necap2XP_006239241.1 DUF1681 6..162 CDD:400335 100/155 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348325
Domainoid 1 1.000 225 1.000 Domainoid score I2452
eggNOG 1 0.900 - - E1_KOG2500
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 265 1.000 Inparanoid score I2980
OMA 1 1.010 - - QHG55046
OrthoDB 1 1.010 - - D1605812at2759
OrthoFinder 1 1.000 - - FOG0003085
OrthoInspector 1 1.000 - - otm45667
orthoMCL 1 0.900 - - OOG6_101944
Panther 1 1.100 - - LDO PTHR12847
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2448
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.