DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9132 and ncap-1

DIOPT Version :9

Sequence 1:NP_996490.1 Gene:CG9132 / 2768881 FlyBaseID:FBgn0030791 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_494398.1 Gene:ncap-1 / 173638 WormBaseID:WBGene00022453 Length:236 Species:Caenorhabditis elegans


Alignment Length:231 Identity:110/231 - (47%)
Similarity:148/231 - (64%) Gaps:28/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYESVLIVKPEVFIYKIPPRASNRGYRAGDWNLKEPTWTGRMRLVAKGTAVVLKLEDKTSGALFA 66
            :||:||:|||:||:|:|||..:: |::|.||||..|.|||||||||.|..:.::|||..:..|:|
 Worm     3 DYENVLMVKPKVFVYRIPPIGTS-GHKAADWNLDSPAWTGRMRLVAIGKRLEMRLEDGETCDLYA 66

  Fly    67 NCPIDTYPGVAIEAVSDSSRYFVIRVQDDNGRSAFLGLGFGDRSDSFDLNVALQDHFKWVKNQEQ 131
            .||||.:||.|||||||||||||||:|:|||:.||:|.||.:|.|:||.||.|||||::::...:
 Worm    67 KCPIDAHPGNAIEAVSDSSRYFVIRLQNDNGQQAFVGCGFQERGDAFDFNVTLQDHFRYIERSAE 131

  Fly   132 IEKEKTEPKQELDLGFKEGETIKINMRITKKDGSEGS-SRTGKNKGSSGVLP--PPPGGLGKI-- 191
            :||:.......|||.||||:||.||  |.|||.|..| .|......:.|::|  |||.|.|.:  
 Worm   132 LEKQDLSAGPSLDLAFKEGQTISIN--IGKKDKSAVSRPRPAPGASTGGLVPLLPPPPGAGSMIR 194

  Fly   192 --------------------APPPAAAAANTTVRQS 207
                                |||||.:::.:|...|
 Worm   195 NSRPSTTTTTASSSLSSAFAAPPPAPSSSTSTTATS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9132NP_996490.1 DUF1681 3..157 CDD:285210 88/153 (58%)
ncap-1NP_494398.1 DUF1681 4..158 CDD:369604 89/156 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163470
Domainoid 1 1.000 191 1.000 Domainoid score I1914
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I2383
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55046
OrthoDB 1 1.010 - - D1605812at2759
OrthoFinder 1 1.000 - - FOG0003085
OrthoInspector 1 1.000 - - oto20598
orthoMCL 1 0.900 - - OOG6_101944
Panther 1 1.100 - - LDO PTHR12847
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4289
SonicParanoid 1 1.000 - - X2448
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.940

Return to query results.
Submit another query.