DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9132 and necap2

DIOPT Version :9

Sequence 1:NP_996490.1 Gene:CG9132 / 2768881 FlyBaseID:FBgn0030791 Length:246 Species:Drosophila melanogaster
Sequence 2:NP_001090764.1 Gene:necap2 / 100037850 XenbaseID:XB-GENE-6049186 Length:266 Species:Xenopus tropicalis


Alignment Length:266 Identity:132/266 - (49%)
Similarity:172/266 - (64%) Gaps:25/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EYESVLIVKPEVFIYKIPPRASNRGYRAGDWNLKEPTWTGRMRLVAKGTAVVLKLEDKTSGALFA 66
            ||||||.|||||.:|:||||:|||||||.||.|.:|.||||:|:.::|....:||||:|||.|||
 Frog     5 EYESVLCVKPEVHVYRIPPRSSNRGYRAADWQLDQPAWTGRLRITSRGKMAYIKLEDRTSGELFA 69

  Fly    67 NCPIDTYPGVAIEAVSDSSRYFVIRVQDDNGRSAFLGLGFGDRSDSFDLNVALQDHFKWVKNQEQ 131
            ..|::.:||:|:|:|.||||||||.::|.|||.||:|:||.||.|:||.||||||||||||.|.:
 Frog    70 QSPVEQFPGIAVESVIDSSRYFVICIEDGNGRRAFIGVGFADRGDAFDFNVALQDHFKWVKQQAE 134

  Fly   132 IEK--EKTEPKQELDLGFKEGETIKINM-RITKKDGSEGSSRTGKNKGSSGVLPPPPGGLGKIAP 193
            :.|  :..:|..:||||||||:|||||: .:.||:|:.||::.....|:..:||||||  .|:..
 Frog   135 LAKQAQNPDPGPKLDLGFKEGQTIKINIANMKKKEGTVGSTKPRPLSGTLNLLPPPPG--AKLPA 197

  Fly   194 PPAA---------------AAANTT---VRQSPGVSPAHRPAAGGSEWTDYASAGGNQGQQNSAN 240
            |.|:               |||:|.   :....|.|....|.|....|.|:..|.|....|.|  
 Frog   198 PSASPAQPFPAQPCPAQPTAAASTAADLLLDLGGSSSWAGPPASSDVWGDFTKASGAPSGQPS-- 260

  Fly   241 ANWVQF 246
            ..||||
 Frog   261 TGWVQF 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9132NP_996490.1 DUF1681 3..157 CDD:285210 97/155 (63%)
necap2NP_001090764.1 DUF1681 6..162 CDD:311748 97/155 (63%)
DNA_pol3_delta2 <188..>248 CDD:331068 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 217 1.000 Domainoid score I2641
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 251 1.000 Inparanoid score I3147
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1605812at2759
OrthoFinder 1 1.000 - - FOG0003085
OrthoInspector 1 1.000 - - oto104166
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2448
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.