DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32500 and NFU3

DIOPT Version :10

Sequence 1:NP_728447.2 Gene:CG32500 / 2768879 FlyBaseID:FBgn0285970 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_567735.1 Gene:NFU3 / 828697 AraportID:AT4G25910 Length:236 Species:Arabidopsis thaliana


Alignment Length:101 Identity:41/101 - (40%)
Similarity:62/101 - (61%) Gaps:2/101 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 IKELLDTRIRPTVQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVES 246
            ::.:|| .:||::..|||::.....:|.||.||:||:|.|||||.:|||.|:::.|:..|||:.|
plant    89 VERVLD-EVRPSLMADGGNVALHEIDGLVVVLKLQGACGSCPSSSMTLKMGIESRLRDKIPEIMS 152

  Fly   247 VEQVFDEADRMIESEFERFEKNLKTLKQQ-EPSGGG 281
            |||..:.....:|...|..||.|..|:.. ..:|||
plant   153 VEQFLESETGGLELNDENIEKVLSELRPYLSGTGGG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32500NP_728447.2 Nfu_N 69..149 CDD:462574
NifU 80..249 CDD:440458 30/66 (45%)
NFU3NP_567735.1 NifU <85..155 CDD:440458 30/66 (45%)
NifU 171..233 CDD:460066 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.