DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33502 and zgc:110319

DIOPT Version :9

Sequence 1:NP_996529.1 Gene:CG33502 / 2768875 FlyBaseID:FBgn0053502 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001018093.2 Gene:zgc:110319 / 796111 ZFINID:ZDB-GENE-050417-345 Length:256 Species:Danio rerio


Alignment Length:207 Identity:117/207 - (56%)
Similarity:148/207 - (71%) Gaps:3/207 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RSMFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGADFVT 129
            |.:.|.|||||||.|||||||..|||.| |.|||...:|.:||||:.||::.|:|.||:|.||:|
Zfish    50 RKLSILTQDTPNPRSLKFLPGKPVLGTG-TQDFPTSASAESSPLARDLFQISGIKSVFYGPDFIT 113

  Fly   130 ISK-QEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPNADTEILEDDDETVMMIKELLDTRIRPT 193
            ::| .:..||:.||.....||..||..|..:...| .:|::.:.|||||.|.:||||||||||||
Zfish   114 LTKTDDDVEWTDIKRHAIEVISKFFEGGEAITTGA-AHAESSVTEDDDEIVSLIKELLDTRIRPT 177

  Fly   194 VQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQVFDEADRMI 258
            |||||||::|.|:|.|.||||:.|||:.||||.||||||:|||:|||||||::||||.||.|.:.
Zfish   178 VQEDGGDVIFKGFEDGTVKLKLVGSCTGCPSSTVTLKNGIQNMMQFYIPEVDNVEQVQDEVDEIN 242

  Fly   259 ESEFERFEKNLK 270
            ...:...||.|:
Zfish   243 MKVYTELEKKLQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33502NP_996529.1 Nfu_N 69..149 CDD:285874 43/80 (54%)
NifU 182..248 CDD:279451 50/65 (77%)
zgc:110319NP_001018093.2 Nfu_N 54..141 CDD:214919 47/87 (54%)
NifU 166..232 CDD:279451 50/65 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0694
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63177
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002982
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101229
Panther 1 1.100 - - O PTHR11178
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2337
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.