DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33502 and CG32857

DIOPT Version :9

Sequence 1:NP_996529.1 Gene:CG33502 / 2768875 FlyBaseID:FBgn0053502 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_728443.1 Gene:CG32857 / 318252 FlyBaseID:FBgn0052857 Length:283 Species:Drosophila melanogaster


Alignment Length:283 Identity:283/283 - (100%)
Similarity:283/283 - (100%) Gaps:0/283 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKFLSQAALNTLRNTRLGSRQLVRSFKGISNTRNHRIPAHQESGCGHSVGCGLLELRMPVACRR 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MSKFLSQAALNTLRNTRLGSRQLVRSFKGISNTRNHRIPAHQESGCGHSVGCGLLELRMPVACRR 65

  Fly    66 SMFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGADFVTI 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly    66 SMFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGADFVTI 130

  Fly   131 SKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPNADTEILEDDDETVMMIKELLDTRIRPTVQ 195
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   131 SKQEGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPNADTEILEDDDETVMMIKELLDTRIRPTVQ 195

  Fly   196 EDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQVFDEADRMIES 260
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   196 EDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQVFDEADRMIES 260

  Fly   261 EFERFEKNLKTLKQQEPSGGGPH 283
            |||||||||||||||||||||||
  Fly   261 EFERFEKNLKTLKQQEPSGGGPH 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33502NP_996529.1 Nfu_N 69..149 CDD:285874 79/79 (100%)
NifU 182..248 CDD:279451 65/65 (100%)
CG32857NP_728443.1 Nfu_N 69..149 CDD:285874 79/79 (100%)
NifU 182..248 CDD:279451 65/65 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473158
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0694
Homologene 1 1.000 - - H6369
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101229
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.730

Return to query results.
Submit another query.