DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33502 and NFU1

DIOPT Version :9

Sequence 1:NP_996529.1 Gene:CG33502 / 2768875 FlyBaseID:FBgn0053502 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001002755.1 Gene:NFU1 / 27247 HGNCID:16287 Length:254 Species:Homo sapiens


Alignment Length:190 Identity:124/190 - (65%)
Similarity:155/190 - (81%) Gaps:3/190 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RSMFIQTQDTPNPESLKFLPGVDVLGKGNTYDFPNGTTAHNSPLAKLLFRVEGVKGVFFGADFVT 129
            |.|||||||||||.||||:||..|| :..|.|||....|..||||:.|||:||||.||||.||:|
Human    57 RYMFIQTQDTPNPNSLKFIPGKPVL-ETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFIT 120

  Fly   130 ISKQ-EGAEWSLIKPEVFAVIMDFFASGLPVLNDAQPNADTEILEDDDETVMMIKELLDTRIRPT 193
            ::|: |..:|:|:||:::|.||||||||||::.:..|:.:.. .|:|||.|.|||||||||||||
Human   121 VTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAG-SEEDDEVVAMIKELLDTRIRPT 184

  Fly   194 VQEDGGDIVFMGYEGGVVKLKMQGSCSSCPSSIVTLKNGVQNMLQFYIPEVESVEQVFDE 253
            |||||||:::.|:|.|:|:||:||||:||||||:|||||:||||||||||||.||||.|:
Human   185 VQEDGGDVIYKGFEDGIVQLKLQGSCTSCPSSIITLKNGIQNMLQFYIPEVEGVEQVMDD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33502NP_996529.1 Nfu_N 69..149 CDD:285874 47/80 (59%)
NifU 182..248 CDD:279451 52/65 (80%)
NFU1NP_001002755.1 Nfu_N 61..148 CDD:214919 53/87 (61%)
NifU 173..241 54/67 (81%)
NifU 173..239 CDD:279451 52/65 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160455
Domainoid 1 1.000 122 1.000 Domainoid score I5677
eggNOG 1 0.900 - - E1_COG0694
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6369
Inparanoid 1 1.050 258 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG63177
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002982
OrthoInspector 1 1.000 - - oto91738
orthoMCL 1 0.900 - - OOG6_101229
Panther 1 1.100 - - LDO PTHR11178
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3877
SonicParanoid 1 1.000 - - X2337
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.