DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33236 and CKB4

DIOPT Version :9

Sequence 1:NP_996432.2 Gene:Ste:CG33236 / 2768873 FlyBaseID:FBgn0053236 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_181996.1 Gene:CKB4 / 819076 AraportID:AT2G44680 Length:283 Species:Arabidopsis thaliana


Alignment Length:178 Identity:73/178 - (41%)
Similarity:108/178 - (60%) Gaps:17/178 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLE----YFSEILDVILKPVIDSSSG 61
            :|.|:.:::|||.||..::||:|.|.|..||:||.||..||.    |:...||:||.  ::||:|
plant    86 VSGSEGDDTSWISWFCNLRGNEFFCEVDEDYIQDDFNLCGLSGQVPYYDYALDLILD--VESSNG 148

  Fly    62 LLYGDE---------KKWYGMIHARYIRSERGLIAMHRKYLRGDFGSCPNISCDRQNTLPVGLSA 117
            .::.:|         :..||:||.|||.:.:|:.||..||...|||.||.:.|..|:.||||.|.
plant   149 DMFTEEQHEMVESAAEMLYGLIHVRYILTTKGMAAMMEKYKNYDFGRCPRVFCCGQSCLPVGQSD 213

  Fly   118 VWGKSTVKIHCPRCKSNFHPKSDTQ--LDGAMFGPSFPDIFFSMLPNL 163
            :...|||||:||:|:..::|:|..|  :|||.||.:||.:|.....|:
plant   214 IPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMAYGNM 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33236NP_996432.2 CK_II_beta 11..166 CDD:198153 70/168 (42%)
CKB4NP_181996.1 CK_II_beta 95..278 CDD:395970 71/169 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.