DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33237 and CG40635

DIOPT Version :9

Sequence 1:NP_996431.2 Gene:Ste:CG33237 / 2768872 FlyBaseID:FBgn0053237 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001104166.2 Gene:CG40635 / 5740827 FlyBaseID:FBgn0085506 Length:88 Species:Drosophila melanogaster


Alignment Length:88 Identity:56/88 - (63%)
Similarity:65/88 - (73%) Gaps:4/88 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSQNN----NSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLEYFSEILDVILKPVIDSSSG 61
            |||.|||    :||||..|||||||:||||||.||:||.||:.|||.|.:.|||.|..|.|.|:.
  Fly     1 MSSHQNNKPILDSSWISSFLGIKGNEFLCRVPIDYIQDPFNRTGLELFPQTLDVFLNLVFDRSTD 65

  Fly    62 LLYGDEKKWYGMIHARYIRSERG 84
            .:.|||:|.|||||||||.|:||
  Fly    66 WVSGDEEKLYGMIHARYIVSKRG 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33237NP_996431.2 CK_II_beta 11..166 CDD:198153 48/74 (65%)
CG40635NP_001104166.2 CK_II_beta 15..>88 CDD:295171 46/72 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448499
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.