DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33237 and Ste:CG33238

DIOPT Version :10

Sequence 1:NP_996431.2 Gene:Ste:CG33237 / 2768872 FlyBaseID:FBgn0053237 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_996430.3 Gene:Ste:CG33238 / 2768902 FlyBaseID:FBgn0053238 Length:172 Species:Drosophila melanogaster


Alignment Length:102 Identity:102/102 - (100%)
Similarity:102/102 - (100%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ALTWQAMIPGFYGMSIVSYVIGQFFFNHPVFEYLTLTGFLFMPVLSPLSCLIFIQIYQKRVLSWW 66
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly   236 ALTWQAMIPGFYGMSIVSYVIGQFFFNHPVFEYLTLTGFLFMPVLSPLSCLIFIQIYQKRVLSWW 300

  Fly    67 YKMIGNPIPDEWLTVLNATRTNATSSVAPSNEIKSKH 103
            |||||||||||||||||||||||||||||||||||||
  Fly   301 YKMIGNPIPDEWLTVLNATRTNATSSVAPSNEIKSKH 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33237NP_996431.2 CK_II_beta 11..166 CDD:198153 93/93 (100%)
Ste:CG33238NP_996430.3 CK_II_beta 10..166 CDD:198153
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.