DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33237 and Ste:CG33241

DIOPT Version :10

Sequence 1:NP_996431.2 Gene:Ste:CG33237 / 2768872 FlyBaseID:FBgn0053237 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_996427.2 Gene:Ste:CG33241 / 2768899 FlyBaseID:FBgn0053241 Length:172 Species:Drosophila melanogaster


Alignment Length:70 Identity:20/70 - (28%)
Similarity:35/70 - (50%) Gaps:10/70 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 YLTLTGFLF-MPVLSPLSCLIFIQIYQKRVLSWWYKMIGNPIPDEWLTVLNATRTNATSSVAPSN 97
            :||.||:.| .|.:.  |.::.|:..|..:    ||.:..|..|. :.|:...:  ...|:||.:
  Fly   313 FLTCTGYTFGFPFVD--SDIVEIKNQQVPL----YKYVFPPNSDS-VAVIGLIQ--PIGSIAPIS 368

  Fly    98 EIKSK 102
            ||:|:
  Fly   369 EIQSR 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33237NP_996431.2 CK_II_beta 11..166 CDD:198153 20/70 (29%)
Ste:CG33241NP_996427.2 CK_II_beta 11..166 CDD:198153
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.