DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ste:CG33237 and Csnk2b

DIOPT Version :9

Sequence 1:NP_996431.2 Gene:Ste:CG33237 / 2768872 FlyBaseID:FBgn0053237 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001290405.1 Gene:Csnk2b / 13001 MGIID:88548 Length:257 Species:Mus musculus


Alignment Length:126 Identity:54/126 - (42%)
Similarity:74/126 - (58%) Gaps:13/126 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSQNNNSSWIDWFLGIKGNQFLCRVPTDYVQDTFNQMGLE----YFSEILDVILKPVID---- 57
            ||||:  ..|||.||.|::||:|.|.|..||:||.||..||.    ::.:.||:||....|    
Mouse     1 MSSSE--EVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELE 63

  Fly    58 ---SSSGLLYGDEKKWYGMIHARYIRSERGLIAMHRKYMRGDFGSCPNISCDRQNTLPVGL 115
               :.|.|:....:..||:||||||.:.||:..|..||.:||||.||.:.|:.|..||:|:
Mouse    64 DNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGI 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ste:CG33237NP_996431.2 CK_II_beta 11..166 CDD:198153 49/116 (42%)
Csnk2bNP_001290405.1 CK_II_beta 8..>129 CDD:198153 50/117 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.