DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and ALKBH7

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_016882844.1 Gene:ALKBH7 / 84266 HGNCID:21306 Length:273 Species:Homo sapiens


Alignment Length:171 Identity:36/171 - (21%)
Similarity:58/171 - (33%) Gaps:61/171 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SDNNIVQRLSISNVESLQTMPGVKSPKDWRTYTLTNHPGIIVIRNPFSERGRRY----WSARCLR 97
            |..:::.||.    ::....||..|..:..|.:....|.:         |.|||    |.|..  
Human    21 SGPSVLSRLQ----DAAVVRPGFLSTAEEETLSRELEPEL---------RRRRYEYDHWDAAI-- 70

  Fly    98 DFPRTPNIVNLNERLFDESVRSDWWKQLNLCSDGVEFQRIKSAMRWTTFGYHHNWDTKIYDEEMQ 162
                         ..|.|:.:|.|.:     :.....||:::|    .||               
Human    71 -------------HGFRETEKSRWSE-----ASRAILQRVQAA----AFG--------------- 98

  Fly   163 SPFPEDLSSLCGLFAQALGYADFKPEAAIVNYYPVGSTLSG 203
             |....|||:..|..:|.||  .||....:.:  .|:|::|
Human    99 -PGQTLLSSVHVLDLEARGY--IKPHVDSIKF--CGATIAG 134



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.