DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and AT1G11780

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_172643.1 Gene:AT1G11780 / 837723 AraportID:AT1G11780 Length:345 Species:Arabidopsis thaliana


Alignment Length:359 Identity:114/359 - (31%)
Similarity:177/359 - (49%) Gaps:73/359 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FKLVFKQ-----YKCKSTSP-DLTEVVKIDDCVVKGNDQEKSDNNIVQRLSISNVESLQTMPGVK 60
            :||.::|     .|.|...| ||:|:  :|..::..|  ..:|..:...:.:|.|:|        
plant    23 YKLYYEQDSKFSRKKKLPKPIDLSEL--LDFNLISQN--FNNDGVLPDGIRVSKVDS-------- 75

  Fly    61 SPKDWRTYTLTNHPGIIVIRNPFSERGRRYWSARCLRDFPRTPNIVNLN------ERLFD----- 114
            ||    .:.:.|.||...|.:..|.:.:..|....|..||:.||..|.|      :.|||     
plant    76 SP----VFCIDNRPGFYFIPDALSLKEQCKWIKESLTSFPQPPNRTNHNAIYGPIDDLFDSAKEN 136

  Fly   115 -----ESVRSDWWK---QLNL-------CSDGVEFQRIKSAMRWTTFGYHHNWDTKIYDEEM-QS 163
                 :.:.::.||   ::::       |. .|....:...:||:|.|...:|..:.||..: .:
plant   137 KVLVQDDLTNNKWKFYEEVDIEKATRSSCK-SVSASVLLRKLRWSTLGLQFDWSKRNYDVSLPHN 200

  Fly   164 PFPEDLSSLCGLFAQALGYAD---FKPEAAIVNYYPVGSTLSGHTDHSEPNKSAPLFSFSFGQTA 225
            ..|:.|..|....| |:...|   |:||.|||||:.:|.||.||.|..|.:.|.|:.|.|.|..|
plant   201 NIPDALCQLAKTHA-AIAMPDGEEFRPEGAIVNYFGIGDTLGGHLDDMEADWSKPIVSMSLGCKA 264

  Fly   226 IFLIGGRSLEEKPTAIYLQSGDVMIMSGESRLCYHAVPRIIKTQASATLSLIIEDVDNADIKTRT 290
            |||:||:|.::.|.|:||:||||::|:||:|.|:|.:|||...:            :||||  ..
plant   265 IFLLGGKSKDDPPHAMYLRSGDVVLMAGEARECFHGIPRIFTGE------------ENADI--GA 315

  Fly   291 IDKDLFHDVGNPQFWEPFSRYMDDSRININIRQV 324
            ::.:|.|:.|:  |   |:.|:..||||||||||
plant   316 LESELSHESGH--F---FAEYIKTSRININIRQV 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
AT1G11780NP_172643.1 2OG-FeII_Oxy_2 86..342 CDD:404425 91/276 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 133 1.000 Domainoid score I1656
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I1780
OMA 1 1.010 - - QHG54092
OrthoDB 1 1.010 - - D1045321at2759
OrthoFinder 1 1.000 - - FOG0004904
OrthoInspector 1 1.000 - - oto3783
orthoMCL 1 0.900 - - OOG6_102830
Panther 1 1.100 - - O PTHR16557
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2064
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.