DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and AT5G01780

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001190202.1 Gene:AT5G01780 / 831672 AraportID:AT5G01780 Length:442 Species:Arabidopsis thaliana


Alignment Length:341 Identity:85/341 - (24%)
Similarity:126/341 - (36%) Gaps:105/341 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SPDLTEVVKIDDCVVKGNDQEKSDNNIVQRLSISNVESL---------QTMPGVKSP-------- 62
            ||  |.:|..|..    |....|.::..|.|.|..|.:.         |:...:|.|        
plant   132 SP--TSMVHFDST----NPSSSSKSSQSQNLKIRKVRNHRNSGFKSRDQSPQRIKDPPPFDICSS 190

  Fly    63 ---------KDW--------RTYTLTN-----HPGIIVIRNPFSERGRRYWSARCLRDFPRTPNI 105
                     |||        .|..::|     .||:::                 |:|| .||:|
plant   191 VLERNDTSIKDWILADETNRETVEVSNKHKVIRPGMVL-----------------LKDF-LTPDI 237

  Fly   106 -VNLNERLFDESVRSDWWKQLNLCSDGVEFQRIKSAMRWTTFGYHHNWD--TKI-YDEEMQSPFP 166
             |::.:...:..|:...:.|..        ..:.|.:.........|||  ||. .:.::.|..|
plant   238 QVDIVKTCRELGVKPTGFYQPG--------YSVGSKLHLQMMCLGRNWDPQTKYRKNTDIDSKAP 294

  Fly   167 EDLSSLCGLFAQAL-----------GYAD-------FKPEAAIVNYYPVGSTLSGHTDHSEPNKS 213
            |...:...|..:|:           |..|       ..|:..|||:|.....|..|.|..|..:|
plant   295 EIPVTFNVLVEKAIREAHALIDRESGTEDAERILPVMSPDICIVNFYSETGRLGLHQDRDESEES 359

  Fly   214 ----APLFSFSFGQTAIFLIGGRSLEEKPTAIYLQSGDVMIMSGESRLCYHAVPRIIKTQASATL 274
                .|:.|||.|.:|.||.|.:...|:...:.|:||||:|..||||:.:|.|..||..  ||.:
plant   360 IARGLPIVSFSIGDSAEFLYGEKRDVEEAQGVILESGDVLIFGGESRMIFHGVKSIIPN--SAPM 422

  Fly   275 SLIIEDVDNADIKTRT 290
            ||:.|.      |.||
plant   423 SLLNES------KLRT 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
AT5G01780NP_001190202.1 2OG-FeII_Oxy_2 225..440 CDD:290266 65/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1045321at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16557
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2064
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.