DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and AT3G14160

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_566479.5 Gene:AT3G14160 / 820633 AraportID:AT3G14160 Length:455 Species:Arabidopsis thaliana


Alignment Length:301 Identity:74/301 - (24%)
Similarity:120/301 - (39%) Gaps:61/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 DCVVKGND-----QEKSDNNIVQRLSISNVESLQTMPGVKSPKDWRTYTLTNH------------ 73
            |.|.:.||     ||...:.:||::.:|:||..::.|......:....:.|.|            
plant   146 DLVNRVNDVTLSCQESVSSTVVQKVELSSVEDQKSAPKADGAGNSSNESSTRHFDIFLEKKGIVL 210

  Fly    74 -PGIIVIRNPFSERGRRYWSARCLRDFPRTPNIVNLNERLF--DESVRSDWWKQLNLCSDGVEFQ 135
             |.::|:.....:..:.| |...:|     |.:|.|...|.  |:.:..:..::|.| .:|..:|
plant   211 KPNLLVLSREKKKAAKGY-SGTVIR-----PGMVLLKNYLSINDQVMIVNKCRRLGL-GEGGFYQ 268

  Fly   136 -----RIKSAMRWTTFGYHHNWD--------TKIYDEEMQSPFPEDLSSLCGLF---AQALGYAD 184
                 ..|..::....|  .|||        |:.:|.......|.:.:......   :|:|..::
plant   269 PGYRDEAKLHLKMMCLG--KNWDPETSRYGETRPFDGSTAPRIPAEFNQFVEKAVKESQSLAASN 331

  Fly   185 FK------------PEAAIVNYYPVGSTLSGHTDHSEP----NKSAPLFSFSFGQTAIFLIGGRS 233
            .|            |:..|||:|.....|..|.|..|.    .|..|:.|||.|.:|.||.|.:.
plant   332 SKQTKGGDEIPFMLPDICIVNFYSSTGRLGLHQDKDESENSIRKGLPVVSFSIGDSAEFLYGDQR 396

  Fly   234 LEEKPTAIYLQSGDVMIMSGESRLCYHAVPRIIKTQASATL 274
            .|:|...:.|:||||::..|.||..:|.|..|.|..|...|
plant   397 DEDKAETLTLESGDVLLFGGRSRKVFHGVRSIRKDTAPKAL 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
AT3G14160NP_566479.5 2OG-FeII_Oxy_2 236..453 CDD:404425 54/205 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1045321at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16557
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2064
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.