DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and AT3G14140

DIOPT Version :10

Sequence 1:NP_996458.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_188030.2 Gene:AT3G14140 / 820631 AraportID:AT3G14140 Length:473 Species:Arabidopsis thaliana


Alignment Length:106 Identity:33/106 - (31%)
Similarity:44/106 - (41%) Gaps:25/106 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PEAAIVNYYPVGSTLSGH---------------------TDHSEPNKS----APLFSFSFGQTAI 226
            |:..:||:|.....|..|                     ||..|..||    .|:.|||.|.:|.
plant   351 PDICVVNFYTSTGKLGLHQVSVYDKTSFDFLKYKGGYLNTDKGESKKSLRKGLPIVSFSIGDSAE 415

  Fly   227 FLIGGRSLEEKPTAIYLQSGDVMIMSGESRLCYHAVPRIIK 267
            ||.|.:...:|...:.|:||||:|....||..:|.|..|.|
plant   416 FLYGDQKDVDKADTLILESGDVLIFGERSRNVFHGVRSIRK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_996458.1 2OG-FeII_Oxy_2 75..267 CDD:433285 32/104 (31%)
AT3G14140NP_188030.2 2OG-FeII_Oxy_2 241..462 CDD:433285 33/106 (31%)

Return to query results.
Submit another query.