DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and AT3G14140

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_188030.2 Gene:AT3G14140 / 820631 AraportID:AT3G14140 Length:473 Species:Arabidopsis thaliana


Alignment Length:106 Identity:33/106 - (31%)
Similarity:44/106 - (41%) Gaps:25/106 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PEAAIVNYYPVGSTLSGH---------------------TDHSEPNKS----APLFSFSFGQTAI 226
            |:..:||:|.....|..|                     ||..|..||    .|:.|||.|.:|.
plant   351 PDICVVNFYTSTGKLGLHQVSVYDKTSFDFLKYKGGYLNTDKGESKKSLRKGLPIVSFSIGDSAE 415

  Fly   227 FLIGGRSLEEKPTAIYLQSGDVMIMSGESRLCYHAVPRIIK 267
            ||.|.:...:|...:.|:||||:|....||..:|.|..|.|
plant   416 FLYGDQKDVDKADTLILESGDVLIFGERSRNVFHGVRSIRK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
AT3G14140NP_188030.2 2OG-FeII_Oxy_2 241..462 CDD:290266 33/106 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1045321at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16557
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2064
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.