DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and alkbh3

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001003511.2 Gene:alkbh3 / 792266 ZFINID:ZDB-GENE-040801-254 Length:282 Species:Danio rerio


Alignment Length:141 Identity:35/141 - (24%)
Similarity:51/141 - (36%) Gaps:37/141 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 KPEAAIVNYYPVGSTLSGHTDHSEPNKS-APLF-SFSFGQTAIFLIGGRSLEEKPTAIYLQSGDV 248
            |..:.:.|.|..|....|....|||:.. .|:. |.|.|.|.:|.:..:.|.|       ..|| 
Zfish   164 KFNSLLCNLYRDGKDSIGWHSDSEPSLGPQPIIASLSLGDTRVFSLRKQPLPE-------DKGD- 220

  Fly   249 MIMSGESRLCYHAVPRIIKTQASATLSLIIEDVDNADIKTRTIDKDLFHDVGNPQFWEPFSRYMD 313
                      :..|.||....|..|| |::|....||.:.:...:  :||.|             
Zfish   221 ----------FTYVERIRVPLAHGTL-LLMEGCTQADWQHQVAKE--YHDRG------------- 259

  Fly   314 DSRININIRQV 324
             .|||:..|.:
Zfish   260 -PRINLTFRTI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
alkbh3NP_001003511.2 2OG-FeII_Oxy_2 81..267 CDD:290266 34/137 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.