DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and Alkbh8

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_006509942.1 Gene:Alkbh8 / 67667 MGIID:1914917 Length:709 Species:Mus musculus


Alignment Length:259 Identity:59/259 - (22%)
Similarity:96/259 - (37%) Gaps:60/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NIVQRLSISNVESLQTMPGVKSPKDWRTYTLTNHPGIIVIRNPFSERGRRYWSARCLRDFPRTPN 104
            |.|::....|: .|:.:|                ||::|:....|..                  
Mouse   163 NFVEKAQWKNM-GLEALP----------------PGLLVVEEIISSE------------------ 192

  Fly   105 IVNLNERLFDESVRSDWWKQLNLCSDGVEFQRIKSAMRWTTFGYHHNWDTKIYDEEMQSPFPEDL 169
                .|:...|||  :|.:.    :....|||.....|...|||..::::...|::  .|.|..|
Mouse   193 ----EEKKLLESV--NWTED----TGNQNFQRSLKHRRVKHFGYEFHYESNTVDKD--KPLPGGL 245

  Fly   170 SSLCGLFAQAL---GYADFKPEAAIVNYYPVGSTLSGHTD-HSEPNKSAPLFSFSFGQTAIFLIG 230
            ..:|....:.|   ||...||:...:|.|..|..:..|.| ||.....  :.|.|.|...:  :.
Mouse   246 PEVCSSILEKLLKEGYIKHKPDQLTINQYEPGHGIPAHIDTHSAFEDE--IISLSLGSAIV--MD 306

  Fly   231 GRSLEEKPTAIYLQSGDVMIMSGESR-LCYHAV-PRIIKT-QASATL--SLIIEDVDNADIKTR 289
            .:..|.....:.|....:::|:|||| |..|.: ||...| |||...  .:|..|:.:..:..|
Mouse   307 FKHPEGVTVQVMLPRRSLLVMTGESRYLWTHGITPRKFDTVQASEQFKGGIITSDIGDLTLSKR 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
Alkbh8XP_006509942.1 DUF1891 46..82 CDD:117570
RRM_ALKBH8 87..167 CDD:240877 2/3 (67%)
2OG-FeII_Oxy 197..379 CDD:389772 49/186 (26%)
Methyltransf_25 455..542 CDD:379312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.