powered by:
Protein Alignment AlkB and Nrp
DIOPT Version :9
Sequence 1: | NP_001334682.1 |
Gene: | AlkB / 2768870 |
FlyBaseID: | FBgn0065035 |
Length: | 332 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001013390.1 |
Gene: | Nrp / 654309 |
-ID: | - |
Length: | 135 |
Species: | Mus musculus |
Alignment Length: | 31 |
Identity: | 7/31 - (22%) |
Similarity: | 11/31 - (35%) |
Gaps: | 6/31 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 LTNHPGIIVIRNP------FSERGRRYWSAR 94
:..:||::....| .|..|...|..|
Mouse 1 MNRNPGVVTPEEPARAGISSSASGPNCWQPR 31
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167842827 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102830 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.830 |
|
Return to query results.
Submit another query.