DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and alkbh5

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001070855.1 Gene:alkbh5 / 570158 ZFINID:ZDB-GENE-061013-602 Length:352 Species:Danio rerio


Alignment Length:197 Identity:49/197 - (24%)
Similarity:68/197 - (34%) Gaps:76/197 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PE----AAIVNYYPVGSTLSGHTD----HSEPNKSAPLFSFS---FGQTAIFLIGGRSLEEKPTA 240
            ||    :|::|.|..|..:..|.|    ...|..|...||.|   ||  ..||.....:.|....
Zfish   151 PEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFG--CKFLFKPIRVSEPVLH 213

  Fly   241 IYLQSGDVMIMSG----------------ESRLCYHAVPRIIKTQASA------TLSLII----- 278
            :.::.|.|.::||                |.|    ||..:.||:|.|      :||..|     
Zfish   214 LPVRRGSVTVLSGYAADDITHCIRPQDIKERR----AVIILRKTRADAPRLDSNSLSPSIVSPKR 274

  Fly   279 ------------EDVDNADIKTRTI--DKDL----------FHDVGNPQ-FW------EPFSRYM 312
                        .|.|.|. :.|.:  ||:|          .||.|:.: .|      ||.:||.
Zfish   275 RHILKAKRSHRKADPDAAH-RPRVLEMDKELQRRSLSSRQRRHDDGSSENSWRRADDREPAARYT 338

  Fly   313 DD 314
            .|
Zfish   339 HD 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
alkbh5NP_001070855.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..47
2OG-FeII_Oxy <104..238 CDD:304390 22/88 (25%)
Alpha-ketoglutarate binding. /evidence=ECO:0000269|PubMed:24561204 161..163 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..352 19/82 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.