DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and alkbh8

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_012812512.2 Gene:alkbh8 / 550051 XenbaseID:XB-GENE-985927 Length:638 Species:Xenopus tropicalis


Alignment Length:216 Identity:52/216 - (24%)
Similarity:82/216 - (37%) Gaps:52/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 PGIIVIRNPFSERGRRYWSARCLRDFPRTPNIVNLNERLFDESVRSDWWKQLNLCSDGVEFQRIK 138
            ||:|::                 .||. :|.    .||...||:  ||..:.: ....::.:|:|
 Frog   146 PGLIIV-----------------EDFV-SPE----QERTMLESI--DWDSETS-SQKSLKHRRVK 185

  Fly   139 SAMRWTTFGYHHNWDTKIYDEEMQSPFPEDLSSLCGLFAQAL------GYADFKPEAAIVNYYPV 197
            .      :||...:|....|::  .|.|..|...|   .:||      |.....|:...:|.|..
 Frog   186 H------YGYEFRYDNNNVDKD--KPLPGGLPDFC---TEALRKCVQIGLIKHDPDQLTINQYEP 239

  Fly   198 GSTLSGHTD-HSEPNKSAPLFSFSFGQTAIFLIGGRSLEEKPTAIYLQSGDVMIMSGESR-LCYH 260
            |..:..|.| ||.....  :.|.|.|  |..::..:........:.|....::||||||| |..|
 Frog   240 GQGIPPHVDTHSAFEDE--ILSLSLG--AEIVMDFKHPNGSVVPVMLPQRSLLIMSGESRYLWTH 300

  Fly   261 AV-PR---IIKTQASATLSLI 277
            .: ||   :|:.....|:..|
 Frog   301 GITPRKFDVIQVSEGQTVGTI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
alkbh8XP_012812512.2 RRM_ALKBH8 52..130 CDD:409865
2OG-FeII_Oxy 147..342 CDD:419693 51/215 (24%)
Methyltransf_25 419..506 CDD:404528
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.