DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and CG14130

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_648511.2 Gene:CG14130 / 39335 FlyBaseID:FBgn0036210 Length:255 Species:Drosophila melanogaster


Alignment Length:136 Identity:25/136 - (18%)
Similarity:51/136 - (37%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RCLRDFPRTPNIVNLNERLF----DESVRSDWWKQLNLCSDGVE-------FQRIKSAMRWTTFG 147
            ||.|....: |.:..|...:    .|:.:.::.:.:.:.:|.:.       .:.|:..|....:.
  Fly    16 RCHRQAVES-NAIKANLTAYFGKWPETEQKEFRQHMRIITDFISEPEEQQLHEEIEPYMSRLRYE 79

  Fly   148 YHHNWDTKIY---DEEMQSPFPEDLSSL--------CGLFAQALGYADFKPEAAIVNYYP----V 197
            :.| ||..|:   :.|.:..||::...|        .|.....:...|..|:..|..:..    .
  Fly    80 FDH-WDDAIHGFRETERKKWFPKNREILERVRQVAFDGAVMPYVHILDLAPDGVIKPHVDSTRYC 143

  Fly   198 GSTLSG 203
            |:|:||
  Fly   144 GNTISG 149



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.