DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and CG17807

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster


Alignment Length:252 Identity:48/252 - (19%)
Similarity:91/252 - (36%) Gaps:66/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NNIVQRLSISNVESLQTMPGVKSPKDWRTYTLTNHP---GIIVIRNPFSERGRRYWSARCLRDFP 100
            :.|.|:.:::.:..::.:|.:....:|      |.|   |:.:|.: |..........|.:.:..
  Fly   103 STIGQQGAVAYLSYIRQLPALAGKSEW------NKPLPRGLHIIAD-FVTEEEESTLLRAIGEDG 160

  Fly   101 RTPNIVNLNERLFDESVRSDWWKQLNLCSDGVEFQRIKSAMRWTTFGYHHNWDTKIYDEEMQSPF 165
            ||..:                       :..::.:.:|.      ||:...:.|...|.  ..|.
  Fly   161 RTSEV-----------------------TGSLKHRNVKH------FGFEFLYGTNNVDP--SKPL 194

  Fly   166 PEDLSSLCGL-------FAQALGYADFKPEAAIVNYYPVGSTLSGHTDHSEPNKSA---PLFSFS 220
            .:.:.|.|.:       ||....::  .|:...||.|..|..:..|.|    ..||   |:.|.|
  Fly   195 EQSIPSACDILWPRLNSFASTWDWS--SPDQLTVNEYEPGHGIPPHVD----THSAFLDPILSLS 253

  Fly   221 FGQTAI--FLIGGRSLEEKPTAIYLQSGDVMIMSGESRLCY-HAV-PRIIKTQASAT 273
            .....:  |..|...::     :.|....::|||||:|..: |.: |:.|....||:
  Fly   254 LQSDVVMDFRRGDDQVQ-----VRLPRRSLLIMSGEARYDWTHGIRPKHIDVVPSAS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877 2/15 (13%)
2OG-FeII_Oxy 136..322 CDD:304390 42/213 (20%)
Methyltransf_11 400..490 CDD:285453
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.