DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and Alkbh3

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001014202.1 Gene:Alkbh3 / 362169 RGDID:1359731 Length:295 Species:Rattus norvegicus


Alignment Length:244 Identity:51/244 - (20%)
Similarity:79/244 - (32%) Gaps:67/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PNIVNLNERLFDESVRSDW----------WKQLNLCSDGVEFQRIKSAMRWTTFGYHHNWDTKIY 157
            |..|:|.|        :||          |||.....:.:.:.:.:....:....|       .|
  Rat    94 PGFVDLKE--------ADWILERLCQDVPWKQRMGIREDITYPQPRLTAWYGELPY-------TY 143

  Fly   158 DEEMQSPFPEDLSSLCGLFAQALGYADFKPEAAIVNYY-PVGSTLSGHTDHSEPNKSAPLF-SFS 220
            ......|.|..|..|..|.::..........:.:.|:| ....::..|:|......|.|:. |.|
  Rat   144 SRVTMEPNPHWLPVLWTLKSRIEENTGHTFNSLLCNFYRDEKDSVDWHSDDEPSLGSCPVIASLS 208

  Fly   221 FGQTAIFLIGGRSLEEKPTAIYLQSGDVMIMSGESRLCYHAVPRIIKTQASATLSLIIEDVDNAD 285
            ||.|..|     .:.:||..  .::||           |..|.|:.......|| ||:|....||
  Rat   209 FGATRTF-----EMRKKPPP--EENGD-----------YTYVERVKIPLDHGTL-LIMEGATQAD 254

  Fly   286 IKTRTIDKDLFHDVGNPQFWEPFSRYMDDSRININIRQVL-----NPGD 329
            .:.|.                |...:..:.|:|:..|.|.     .|||
  Rat   255 WQHRV----------------PKEYHSRERRVNLTFRTVYPDPRGAPGD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
Alkbh3NP_001014202.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
2OG-FeII_Oxy 90..275 CDD:419693 46/230 (20%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q6NS38 141..143 1/8 (13%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250|UniProtKB:Q96Q83 179..181 1/1 (100%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250|UniProtKB:Q96Q83 269..275 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.