DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and alkb-7

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001022442.1 Gene:alkb-7 / 3564894 WormBaseID:WBGene00012920 Length:227 Species:Caenorhabditis elegans


Alignment Length:192 Identity:31/192 - (16%)
Similarity:63/192 - (32%) Gaps:75/192 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 NWDTKIY---DEEMQSPFPEDLSSLCGLFAQALG--------------YAD--FKPEAAIVNYYP 196
            :||..|:   :.|.:....|:|..:..:.:::.|              :.|  .||....:.|  
 Worm    64 HWDDAIHLYREREQRKWRDENLEVISRIRSESFGANTEHLTYVHILDLHKDGVIKPHIDAIRY-- 126

  Fly   197 VGSTLSG------------HTDHSEPNKSAPLFSFSFGQTAIFLIGG--------RSLEEKPTAI 241
            .|..::|            |.|    .|...:......:.:::.:||        ..|.|:.:  
 Worm   127 CGDVITGVSLLSDAIMRLRHKD----QKDELIMDLLMPRRSLYRLGGPGRYDFTHEVLGEQES-- 185

  Fly   242 YLQSGDVMIMSGESRLCYHAVPRIIKTQASATLSLIIEDVDNA--------DIKTRTIDKDL 295
                    :.:||.      |||      ...:|:|..|:...        :||.:.|.:::
 Worm   186 --------VWNGEQ------VPR------ERRISIICRDLPKVANRQTAEEEIKLKPIPEEI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
alkb-7NP_001022442.1 2OG-FeII_Oxy <117..179 CDD:389772 10/67 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.