DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and Alkbh2

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:XP_006249560.1 Gene:Alkbh2 / 304578 RGDID:1306377 Length:287 Species:Rattus norvegicus


Alignment Length:120 Identity:26/120 - (21%)
Similarity:48/120 - (40%) Gaps:20/120 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LCGLFAQALGYADFKPEAAIVNYYPVGSTLSG--HTDHSEPNKSAPLFSFSFGQTAIFLIGGR-S 233
            :|.:..|...:       .:||.|..|....|  ..|..|....:|:.|.|||.....|...: |
  Rat   171 VCRVTGQTFNF-------VLVNRYKDGCDHIGEHRDDERELAPGSPIASVSFGACRDILFRHKDS 228

  Fly   234 LEEKP------TAIYLQSGDVMIMSGESRL-CYHAVP---RIIKTQASATLSLII 278
            ..::|      ..:.|..|.:::|:..:.. .||::|   |::..:.:.|...|:
  Rat   229 RGKRPRRAVEVVRLQLAHGSLLMMNHPTNTHWYHSLPIRKRVLAPRINLTFRKIL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
Alkbh2XP_006249560.1 2OG-FeII_Oxy_2 98..280 CDD:290266 25/115 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.