DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AlkB and Alkbh5

DIOPT Version :9

Sequence 1:NP_001334682.1 Gene:AlkB / 2768870 FlyBaseID:FBgn0065035 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001178572.1 Gene:Alkbh5 / 303193 RGDID:1309496 Length:395 Species:Rattus norvegicus


Alignment Length:121 Identity:28/121 - (23%)
Similarity:51/121 - (42%) Gaps:22/121 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PE----AAIVNYYPVGSTLSGHTD--HSEPNKSAPLFSFSFGQTAIFLIGGR------SLEEKPT 239
            ||    :|::|.|..|..:..|.|  |.   ...|:.|.||...:....|.:      .:.|...
  Rat   184 PEGFVNSAVINDYQPGGCIVSHVDPIHI---FERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVL 245

  Fly   240 AIYLQSGDVMIMSG----ESRLCYHAVPRIIKTQASATLSLIIEDVDNADIKTRTI 291
            ::.::.|.|.::||    |...|..  |:.|| :..|.:.|....:|...::|:::
  Rat   246 SLPVRRGSVTVLSGYAADEITHCIR--PQDIK-ERRAVIILRKTRLDAPRLETKSL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AlkBNP_001334682.1 None
Alkbh5NP_001178572.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..83
2OG-FeII_Oxy <137..271 CDD:419693 21/91 (23%)
Alpha-ketoglutarate binding. /evidence=ECO:0000250|UniProtKB:Q6P6C2 194..196 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 294..395 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3145
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.