DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:238 Identity:65/238 - (27%)
Similarity:98/238 - (41%) Gaps:34/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SLNDLTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQ 105
            :||::.: |.|.|.|:. .|::........|.|.|||.|:..|:||......|||.:.:..|.:.
  Fly    43 TLNNVIS-EDPEFTDVI-ENITVPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNP 105

  Fly   106 RFSVIHPPGSE--DWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYD 168
            |.||.|....:  .|.|.|:..|..|.|.|.||:||.........::|:...:..|..|      
  Fly   106 RISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALT------ 164

  Fly   169 TKSARAKILGSTEIHVKRDSTIALACSV-NIHAPSVIWYH--GSSVVDFDSLRGGISLETEKTDV 230
                      |::|.|:....:.|.|.. ....|::.|..  |:.:|        |:...|..|:
  Fly   165 ----------SSDIIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIV--------INKTLEVHDL 211

  Fly   231 GTTSRLMLTRASLRDSGNYTCVPNGAIPASV--RVHVLTGEQP 271
            .|.| |.|.|.|....|.|.|:.:..:|.||  |:.|.....|
  Fly   212 ETDS-LELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 29/90 (32%)
IG_like 58..140 CDD:214653 28/83 (34%)
IG_like 179..265 CDD:214653 25/90 (28%)
Ig 187..257 CDD:299845 18/72 (25%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 30/95 (32%)
Ig 69..139 CDD:143165 25/69 (36%)
IG_like 165..249 CDD:214653 26/92 (28%)
IGc2 172..237 CDD:197706 18/73 (25%)
IG_like 267..348 CDD:214653
Ig 270..339 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.