DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and igsf9bb

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_009293693.1 Gene:igsf9bb / 569554 ZFINID:ZDB-GENE-091112-15 Length:1439 Species:Danio rerio


Alignment Length:222 Identity:51/222 - (22%)
Similarity:84/222 - (37%) Gaps:55/222 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LERPFFDDISPRNVSAVVDEIAILRCRVK-NKGNRTVSWMRKRDLHILTTNIYTYTGD--QRFSV 109
            ::.|.|....|.|::..:.:.|...|:.: ..||.|.:|..:.|      |:: :..|  :|.|:
Zfish   223 VQGPPFIVSPPENITVNISQDAFFTCQAEAYPGNLTYTWFWEED------NVF-FKNDLKRRVSI 280

  Fly   110 IHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARA 174
            :     .|..|.|...:|.|:|.|.|    .|..:|.......|             |.|....|
Zfish   281 L-----IDGSLIISQVKPEDAGKYTC----SPSNSLGRPPSASA-------------YLTVHYPA 323

  Fly   175 KILGSTE-IHVKRDSTIALACSVNIHAP--SVIWYHGSSVVDFDSLRGGISLETEK------TDV 230
            :::.... |:|.......:.|.|:.:.|  ||.|           .:.|:.|..||      .:.
Zfish   324 RVINMPPVIYVAIGLPGYIRCPVDANPPVTSVKW-----------KKDGLPLRIEKYPGWSQMED 377

  Fly   231 GTTSRLMLTRASLRDSGNYTCVPNGAI 257
            |:.....:|..||   |.|||||..::
Zfish   378 GSIRVSEVTEDSL---GTYTCVPYNSL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 22/91 (24%)
IG_like 58..140 CDD:214653 21/84 (25%)
IG_like 179..265 CDD:214653 22/88 (25%)
Ig 187..257 CDD:299845 20/77 (26%)
igsf9bbXP_009293693.1 IG_like 30..113 CDD:214653
Ig 41..113 CDD:143165
IG_like 144..223 CDD:214653 51/222 (23%)
IGc2 151..208 CDD:197706
I-set 227..319 CDD:254352 26/120 (22%)
Ig <263..319 CDD:299845 17/84 (20%)
Ig_2 326..414 CDD:290606 22/90 (24%)
IG_like 329..403 CDD:214653 22/87 (25%)
IG_like 424..504 CDD:214653
Ig 440..504 CDD:299845
FN3 509..604 CDD:238020
FN3 620..704 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.