DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr7 and tmigd1

DIOPT Version :9

Sequence 1:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001091718.1 Gene:tmigd1 / 559127 ZFINID:ZDB-GENE-080303-6 Length:251 Species:Danio rerio


Alignment Length:255 Identity:53/255 - (20%)
Similarity:91/255 - (35%) Gaps:65/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VSAVVDEIAILRCRVKN---KGNRTVSWMRK-RDLHILTTNIYTYTGDQRFSV-IHPPGSEDWDL 120
            :...|:|...|.|...|   ...:.:.|.|. ..:.:...|:.:     |.|: :.|...||   
Zfish    36 LQTAVEETVTLTCMTDNTDPSSQQELQWFRNGARVKLPEENMMS-----RSSLCVQPVTKED--- 92

  Fly   121 KIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVK 185
                    |..|:.||:..:..:|..:...|....|..|                   :.|:.|:
Zfish    93 --------DGAVFTCQLKGDASVNSTVEFDVSYPPDLND-------------------TIEVFVQ 130

  Fly   186 RDSTIALACSVNIHAP-SVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRD--SG 247
            ..:...|:|.|..:.| :|:|.....|:|   |..|   ..:.|:.|.|::|.:.:.. ||  .|
Zfish   131 ETNDAVLSCEVRANPPVTVVWKKDGEVLD---LTTG---SYKSTNNGITAQLTIPKLK-RDVHQG 188

  Fly   248 NYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRAF------TAMITIISTKVLLYIS 301
            .|.|....|      ::.:||.   ..|.:...|:..|      ..::.:..|.||..||
Zfish   189 LYVCETKSA------MYGVTGR---TFQVTVEDRVIGFPLGPTIAGVVVVACTIVLALIS 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr7NP_001096850.2 V-set 56..145 CDD:284989 17/88 (19%)
IG_like 58..140 CDD:214653 17/83 (20%)
IG_like 179..265 CDD:214653 22/88 (25%)
Ig 187..257 CDD:299845 19/72 (26%)
tmigd1NP_001091718.1 Ig 43..>100 CDD:299845 13/72 (18%)
IG_like 129..210 CDD:214653 24/96 (25%)
Ig 135..193 CDD:143165 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1099491at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.